H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000027156 Last modified: 27-May-2015
Definition: Similar to Vitamin K-dependent protein Z isoform 1 precursor.
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000027156
Length 422
Codon Adaptation Index (CAI). 0.765
Database links RefSeq NA
UniProt NA
CCDS
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000195810
H-Inv cluster ID Locus view HIX0037352
Predicted CDS 8..1276 ; 422[aa] ; Orientation:+2 ;
Genomic location Chromosome 13
Location 13q34
CDS position 113812968-113826694
Strand +
Accession number M55671.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center NBRC     Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PROZ) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PROZ) ;
Length of cDNA 1551[bp] (No. of exon:9)[A:390 T:316 G:426 C:419] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8858 ;
KEGG GENES KEGG GENES(8858) ;
GeneCard GeneCard PROZ ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000195810
H-Inv cluster IDLocus view HIX0037352
Accession numberM55671.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSimilar to Vitamin K-dependent protein Z isoform 1 precursor.
Similarity category HelpSimilar to known protein(Category II).
Similar to known protein (NP_001243063) [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Transcript feature Help Representative H-Inv IDRepresentative transcript; Splicing isoformSplicing isoform;
Genomic Location G-integra Help Chromosome13
Location13q34
CDS position113812968-113826694
Strand+
Gene structure9 exons

Motif information in predicted CDS
ORF

length(423),orf(8:1276)
MAGCVPLLQGLVLVLALHRVEPSATSLKERHGLHSDSACTGVQESLFLPA
SKANDVLVRWKRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENEVVT
DEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNE
CHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTS
EKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITV
KTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGL
PVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECG
QVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGG
QAHMVLVTKVSRYSLWFKQIMN*
a.a.
length
InterPro Name
length(65), motif(44:108) 65IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(47), motif(63:109) 47IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(44), motif(65:108) 44IPR017857Coagulation factor, subgroup, Gla domain [Domain]
length(62), motif(65:126) 62IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(14), motif(67:80) 14IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(42), motif(68:109) 42IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(26), motif(79:104) 26IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(14), motif(81:94) 14IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(15), motif(95:109) 15IPR000294Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(37), motif(109:145) 37IPR000742Epidermal growth factor-like domain [Domain]
length(34), motif(112:145) 34IPR000742Epidermal growth factor-like domain [Domain]
length(29), motif(115:143) 29IPR000742Epidermal growth factor-like domain [Domain]
length(12), motif(124:135) 12IPR000152EGF-type aspartate/asparagine hydroxylation site [PTM]
length(12), motif(133:144) 12IPR013032EGF-like, conserved site [Conserved_site]
length(39), motif(150:188) 39IPR000742Epidermal growth factor-like domain [Domain]
length(264), motif(159:422) 264IPR009003Trypsin-like cysteine/serine peptidase domain [Domain]
length(16), motif(172:187) 16IPR013032EGF-like, conserved site [Conserved_site]
length(226), motif(197:422) 226IPR001254Peptidase S1 [Domain]
length(220), motif(198:417) 220IPR001254Peptidase S1 [Domain]
length(209), motif(208:416) 209IPR001254Peptidase S1 [Domain]

Protein function information
H-Inv protein ID HIP000027156
Representative H-Inv transcript ID Transcript view HIT000195810
H-Inv cluster ID Locus view HIX0037352
Definition Similar to Vitamin K-dependent protein Z isoform 1 precursor.
Similarity category Help Similar to known protein(Category II).
Similar to known protein (NP_001243063) [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
UniProt
CCDS
Gene symbol/name HGNC symbol PROZ
HGNC aliases NA
HGNC name protein Z, vitamin K-dependent plasma glycoprotein;
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT extracellular;
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified : 27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
63 107 1danL3 7e-09 31.8 44/48 g.32.1.1
111 152 1ivoC 1e-08 28.6 42/47 g.3.11.1
132 392 1bglA4 6e-13 6.0 252/293 b.30.5.1
Related H-InvDB links GTOP GTOP

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
20..20 G/A rs200554473 + CDS Nonsynonymous[Val5Ile]
33..33 A/T rs199716055 + CDS Nonsynonymous[Gln9Leu]
38..38 C/G rs148527063 + CDS Nonsynonymous[Leu11Val]
43..43 C/T rs142938221 + CDS Synonymous[Val12Val]
55..55 C/T rs150663126 + CDS Synonymous[Ala16Ala]
77..77 G/A rs1885956 + CDS Nonsynonymous[Ala24Thr]
130..130 C/T rs117488806 + CDS Synonymous[Gly41Gly]
153..153 C/T rs201823929 + CDS Nonsynonymous[Pro49Leu]
169..169 C/T rs140203873 + CDS Synonymous[Asn54Asn]
173..173 G/A rs143900275 + CDS Nonsynonymous[Val56Ile]
192..192 G/A rs200021724 + CDS Nonsynonymous[Arg62His]
258..258 T/A rs146864768 + CDS Nonsynonymous[Ile84Asn]
268..268 T/A rs140812852 + CDS AA-STOP[Tyr87*]
281..281 G/A rs3024778 + CDS Nonsynonymous[Glu92Lys]
306..306 C/G rs79203568 + CDS Nonsynonymous[Thr100Ser]
316..316 C/T rs201055839 + CDS Synonymous[Phe103Phe]
328..328 T/C rs3024723 + CDS Synonymous[Tyr107Tyr]
335..335 G/A rs199755961 + CDS Nonsynonymous[Gly110Ser]
342..342 C/G rs145523497 + CDS Nonsynonymous[Pro112Arg]
353..353 C/T rs111856642 + CDS AA-STOP[Gln116*]
371..371 G/A rs148844137 + CDS Nonsynonymous[Gly122Ser]
418..418 C/T rs186968607 + CDS Synonymous[Pro137Pro]
520..520 G/A rs564081 + CDS Synonymous[Thr171Thr]
522..522 G/C rs199965278 + CDS Nonsynonymous[Cys172Ser]
528..528 G/A rs148031677 + CDS Nonsynonymous[Cys174Tyr]
592..592 C/A rs183762960 + CDS AA-STOP[Cys195*]
610..610 G/C rs201874723 + CDS Nonsynonymous[Glu201Asp]
614..614 C/T rs142314013 + CDS Nonsynonymous[Arg203Cys]
640..640 G/A rs146163809 + CDS Synonymous[Pro211Pro]
662..662 T/C rs138885452 + CDS Nonsynonymous[Ser219Pro]
665..665 G/A rs143024570 + CDS Nonsynonymous[Glu220Lys]
720..720 C/T rs200554916 + CDS Nonsynonymous[Thr238Ile]
745..745 G/A rs150819115 + CDS Synonymous[Arg246Arg]
767..767 T/G rs138237894 + CDS Nonsynonymous[Phe254Val]
778..778 G/A rs149586261 + CDS Synonymous[Thr257Thr]
782..782 C/A rs144364121 + CDS Nonsynonymous[Gln259Lys]
811..811 C/T rs200261240 + CDS Synonymous[His268His]
812..812 G/A rs140132416 + CDS Nonsynonymous[Val269Ile]
823..823 C/G rs199523691 + CDS Nonsynonymous[His272Gln]
827..827 C/T rs143760342 + CDS Nonsynonymous[Arg274Trp]
828..828 G/A rs141140968 + CDS Nonsynonymous[Arg274Gln]
838..838 G/A rs201042447 + CDS Synonymous[Ala277Ala]
842..842 G/A rs189464617 + CDS Nonsynonymous[Ala279Thr]
849..849 A/T rs146398692 + CDS Nonsynonymous[Glu281Val]
897..897 G/A rs139742813 + CDS Nonsynonymous[Gly297Asp]
935..935 G/A rs199645640 + CDS Nonsynonymous[Ala310Thr]
940..940 G/A rs142075303 + CDS Synonymous[Glu311Glu]
944..944 C/T rs114412052 + CDS Nonsynonymous[Leu313Phe]
947..947 C/T rs140236962 + CDS Nonsynonymous[Leu314Phe]
956..956 C/T rs149903852 + CDS Nonsynonymous[Arg317Cys]
957..957 G/A rs3024772 + CDS Nonsynonymous[Arg317His]
973..973 C/T rs74115810 + CDS Synonymous[Leu322Leu]
976..976 C/T rs3024773 + CDS Synonymous[Ser323Ser]
986..986 C/T rs200894631 + CDS Nonsynonymous[Arg327Cys]
1020..1020 C/T rs200473651 + CDS Nonsynonymous[Thr338Met]
1021..1021 G/A rs3024774 + CDS Synonymous[Thr338Thr]
1084..1084 C/T rs139164186 + CDS Synonymous[Thr359Thr]
1126..1126 G/C rs147857980 + CDS Nonsynonymous[Trp373Cys]
1191..1191 C/T rs141423743 + CDS Nonsynonymous[Ser395Leu]
1233..1233 A/G rs143678466 + CDS Nonsynonymous[Lys409Arg]
1262..1262 C/G rs202097128 + CDS Nonsynonymous[Gln419Glu]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;