H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000030739 Last modified: 27-May-2015
Definition: Similar to Protein RRP5 homolog.
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000030739
Length 1434
Codon Adaptation Index (CAI). 0.765
Database links RefSeq NA
UniProt NA
CCDS NA
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000261406
H-Inv cluster ID Locus view HIX0009176
Predicted CDS 81..4384 ; 1434[aa] ; Orientation:+3 ;
Genomic location Chromosome 10
Location 10q24.33
CDS position 105156419-105200184
Strand +
Accession number BC064486.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:5930738
Experimental resources NBRC: NITE Biological Resource Center NBRC      
Length of cDNA 4384[bp] (No. of exon:29)[A:1144 T:979 G:1185 C:1076] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:22984 ;
KEGG GENES KEGG GENES(22984) ;
GeneCard GeneCard NA
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000261406
H-Inv cluster IDLocus view HIX0009176
Accession numberBC064486.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSimilar to Protein RRP5 homolog.
Similarity category HelpSimilar to known protein(Category II).
Similar to known protein (NP_055791) [Identity/coverage = 99.442%/76.64%] to Homo sapiens protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome10
Location10q24.33
CDS position105156419-105200184
Strand+
Gene structure29 exons
No.2
H-Inv IDTranscript view HIT000265829
H-Inv cluster IDLocus view HIX0009176
Accession numberBC080560.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSimilar to Protein RRP5 homolog.
Similarity category HelpSimilar to known protein(Category II).
Similar to known protein (NP_055791) [Identity/coverage = 99.442%/76.64%] to Homo sapiens protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome10
Location10q24.33
CDS position105156419-105200184
Strand+
Gene structure29 exons

Motif information in predicted CDS
ORF

length(1434),orf(81:4384)
MANLEESFPRGGTRKIHKPEKAFQQSVEQDNLFDISTEEGSTKRKKSQKG
PAKTKKLKIEKRESSKSAREKFEILSVESLCEGMRILGCVKEVNELELVI
SLPNGLQGFVQVTEICDAYTKKLNEQVTQEQPLKDLLHLPELFSPGMLVR
CVVSSLGITDRGKKSVKLSLNPKNVNRVLSAEALKPGMLLTGTVSSLEDH
GYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLNCIVEKVKGNG
GVVSLSVGHSEVSTAIATEQQSWNLNNLLPGLVVKAQVQKVTPFGLTLNF
LTFFTGVVDFMHLDPKKAGTYFSNQAVRACILCVHPRTRVVHLSLRPIFL
QPGRPLTRLSCQNLGAVLDDVPVQGFFKKAGATFRLKDGVLAYARLSHLS
DSKNVFNPEAFKPGNTHKCRIIDYSQMDELALLSLRTSIIEAQYLRYHDI
EPGAVVKGTVLTIKSYGMLVKVGEQMRGLVPPMHLADILMKNPEKKYHIG
DEVKCRVLLCDPEAKKLMMTLKKTLIESKLPVITCYADAKPGLQTHGFII
RVKDYGCIVKFYNNVQGLVPKHELSTEYIPDPERVFYTGQVVKVVVLNCE
PSKERMLLSFKLSSDPEPKKEPAGHSQKKGKAINIGQLVDVKVLEKTKDG
LEVAVLPHNIRAFLPTSHLSDHVANGPLLHHWLQAGDILHRVLCLSQSEG
RVLLCRKPALVSTVEGGQDPKNFSEIHPGMLLIGFVKSIKDYGVFIQFPS
GLSGLAPKAIMSDKFVTSTSDHFVEGQTVAAKVTNVDEEKQRMLLSLRLS
DCGLGDLAITSLLLLNQCLEELQGVRSLMSNRDSVLIQTLAEMTPGMFLD
LVVQEVLEDGSVVFSGGPVPDLVLKASRYHRAGQEVESGQKKKVVILNVD
LLKLEVHVSLHQDLVNRKARKLRKGSEHQAIVQHLEKSFAIASLVETGHL
AAFSLTSHLNDTFRFDSEKLQVGQGVSLTLKTTEPGVTGLLLAVEGPAAK
RTMRPTQKDSETVDEDEEVDPALTVGTIKKHTLSIGDMVTGTVKSIKPTH
VVVTLEDGIIGCIHASHILDDVPEGTSPTTKLKVGKTVTARVIGGRDMKT
FKYLPISHPRFVRTIPELSVRPSELEDGHTALNTHSVSPMEKIKQYQAGQ
TVTCFLKKYNVVKKWLEVEIAPDIRGRIPLLLTSLSFKVLKHPDKKFRVG
QALRATVVGPDSSKTFLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSF
PFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSS
RTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGL
ARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDT
GKPDVLSASLEGQLTKQEERKTEAEERDQKKKKK
a.a.
length
InterPro Name
length(102), motif(73:174) 102IPR012340Nucleic acid-binding, OB-fold [Domain]
length(100), motif(76:175) 100IPR012340Nucleic acid-binding, OB-fold [Domain]
length(91), motif(81:171) 91IPR022967RNA-binding domain, S1 [Domain]
length(89), motif(83:171) 89IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(116), motif(168:283) 116IPR012340Nucleic acid-binding, OB-fold [Domain]
length(82), motif(179:260) 82IPR012340Nucleic acid-binding, OB-fold [Domain]
length(73), motif(185:257) 73IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(74), motif(185:258) 74IPR022967RNA-binding domain, S1 [Domain]
length(72), motif(187:258) 72IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(87), motif(267:353) 87IPR012340Nucleic acid-binding, OB-fold [Domain]
length(79), motif(270:348) 79IPR012340Nucleic acid-binding, OB-fold [Domain]
length(68), motif(279:346) 68IPR022967RNA-binding domain, S1 [Domain]
length(66), motif(281:346) 66IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(74), motif(363:436) 74IPR022967RNA-binding domain, S1 [Domain]
length(72), motif(365:436) 72IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(89), motif(441:529) 89IPR012340Nucleic acid-binding, OB-fold [Domain]
length(80), motif(445:524) 80IPR012340Nucleic acid-binding, OB-fold [Domain]
length(72), motif(451:522) 72IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(72), motif(451:522) 72IPR022967RNA-binding domain, S1 [Domain]
length(70), motif(453:522) 70IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(84), motif(534:617) 84IPR012340Nucleic acid-binding, OB-fold [Domain]
length(80), motif(536:615) 80IPR012340Nucleic acid-binding, OB-fold [Domain]
length(72), motif(540:611) 72IPR022967RNA-binding domain, S1 [Domain]
length(70), motif(542:611) 70IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(64), motif(547:610) 64IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(84), motif(627:710) 84IPR012340Nucleic acid-binding, OB-fold [Domain]
length(80), motif(631:710) 80IPR012340Nucleic acid-binding, OB-fold [Domain]
length(74), motif(634:707) 74IPR022967RNA-binding domain, S1 [Domain]
length(72), motif(636:707) 72IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(83), motif(719:801) 83IPR012340Nucleic acid-binding, OB-fold [Domain]
length(78), motif(721:798) 78IPR012340Nucleic acid-binding, OB-fold [Domain]
length(72), motif(727:798) 72IPR022967RNA-binding domain, S1 [Domain]
length(71), motif(728:798) 71IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(70), motif(729:798) 70IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(68), motif(844:911) 68IPR022967RNA-binding domain, S1 [Domain]
length(76), motif(1029:1104) 76IPR012340Nucleic acid-binding, OB-fold [Domain]
length(63), motif(1032:1094) 63IPR012340Nucleic acid-binding, OB-fold [Domain]
length(76), motif(1034:1109) 76IPR022967RNA-binding domain, S1 [Domain]
length(61), motif(1035:1095) 61IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(74), motif(1036:1109) 74IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(87), motif(1136:1222) 87IPR012340Nucleic acid-binding, OB-fold [Domain]
length(79), motif(1143:1221) 79IPR012340Nucleic acid-binding, OB-fold [Domain]
length(76), motif(1147:1222) 76IPR022967RNA-binding domain, S1 [Domain]
length(74), motif(1149:1222) 74IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(88), motif(1225:1312) 88IPR012340Nucleic acid-binding, OB-fold [Domain]
length(77), motif(1226:1302) 77IPR012340Nucleic acid-binding, OB-fold [Domain]
length(71), motif(1228:1298) 71IPR022967RNA-binding domain, S1 [Domain]
length(69), motif(1230:1298) 69IPR003029Ribosomal protein S1, RNA-binding domain [Domain]
length(91), motif(1305:1395) 91IPR012340Nucleic acid-binding, OB-fold [Domain]
length(89), motif(1310:1398) 89IPR012340Nucleic acid-binding, OB-fold [Domain]
length(75), motif(1322:1396) 75IPR022967RNA-binding domain, S1 [Domain]
length(73), motif(1324:1396) 73IPR003029Ribosomal protein S1, RNA-binding domain [Domain]

Protein function information
H-Inv protein ID HIP000030739
Representative H-Inv transcript ID Transcript view HIT000261406
H-Inv cluster ID Locus view HIX0009176
Definition Similar to Protein RRP5 homolog.
Similarity category Help Similar to known protein(Category II).
Similar to known protein (NP_055791) [Identity/coverage = 99.442%/76.64%] to Homo sapiens protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction 1
Interaction partner(s) HIP000097336;
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
UniProt NA
CCDS NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT cytosol;
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
116..116 T/G rs141156601 + CDS Synonymous[Gly12Gly]
213..213 A/G rs150893869 + CDS Nonsynonymous[Lys45Glu]
245..245 A/T rs138114093 + CDS Nonsynonymous[Lys55Asn]
281..281 C/T rs149531106 + CDS Synonymous[Ser67Ser]
351..351 A/C rs200633931 + CDS Nonsynonymous[Lys91Gln]
356..356 G/A rs147201653 + CDS Synonymous[Glu92Glu]
357..357 G/T rs200821951 + CDS Nonsynonymous[Val93Leu]
368..368 G/A rs140523371 + CDS Synonymous[Leu96Leu]
391..391 A/G rs142790276 + CDS Nonsynonymous[Asn104Ser]
437..437 C/T rs183788679 + CDS Synonymous[Tyr119Tyr]
465..465 C/A rs78125145 + CDS Nonsynonymous[Gln129Lys]
488..488 A/G rs7914506 + CDS Synonymous[Leu136Leu]
518..518 A/T rs148732555 + CDS Synonymous[Gly146Gly]
534..534 G/A rs199919341 + CDS Nonsynonymous[Val152Met]
549..549 G/C rs61756019 + CDS Nonsynonymous[Gly157Arg]
764..764 C/G rs151246713 + CDS Nonsynonymous[Asn228Lys]
827..827 C/T rs139423894 + CDS Synonymous[Asn249Asn]
871..871 C/T rs61731093 + CDS Nonsynonymous[Thr264Met]
923..923 A/G rs200291968 + CDS Synonymous[Gly281Gly]
927..927 G/C rs191666554 + CDS Nonsynonymous[Val283Leu]
971..971 G/A rs201307851 + CDS Synonymous[Thr297Thr]
994..994 C/T rs146625130 + CDS Nonsynonymous[Thr305Met]
995..995 G/A rs201957446 + CDS Synonymous[Thr305Thr]
999..999 G/A rs141352682 + CDS Nonsynonymous[Val307Met]
1011..1011 A/G rs190994349 + CDS Nonsynonymous[Met311Val]
1020..1020 G/A rs201397125 + CDS Nonsynonymous[Asp314Asn]
1027..1027 A/G rs111421816 + CDS Nonsynonymous[Lys316Arg]
1039..1039 C/T rs145088287 + CDS Nonsynonymous[Thr320Ile]
1046..1046 C/G rs145535929 + CDS Nonsynonymous[Phe322Leu]
1080..1080 G/A rs148850392 + CDS Nonsynonymous[Val334Ile]
1104..1104 C/A rs200342633 + CDS Nonsynonymous[His342Asn]
1105..1105 A/G rs199928401 + CDS Nonsynonymous[His342Arg]
1152..1152 C/G rs143460544 + CDS Nonsynonymous[Arg358Gly]
1168..1168 A/C rs201726517 + CDS Nonsynonymous[Asn363Thr]
1264..1264 G/A rs147977386 + CDS Nonsynonymous[Arg395Gln]
1270..1270 G/A rs7074814 + CDS Nonsynonymous[Ser397Asn]
1315..1315 A/G rs143384865 + CDS Nonsynonymous[Lys412Arg]
1321..1321 G/A rs201230473 + CDS Nonsynonymous[Gly414Glu]
1387..1387 G/A rs146207561 + CDS Nonsynonymous[Arg436Gln]
1390..1390 C/T rs138880245 + CDS Nonsynonymous[Thr437Met]
1394..1394 T/C rs142809675 + CDS Synonymous[Ser438Ser]
1395..1395 A/G rs145031913 + CDS Nonsynonymous[Ile439Val]
1408..1408 A/G rs147402275 + CDS Nonsynonymous[Gln443Arg]
1428..1428 A/G rs200574458 + CDS Nonsynonymous[Ile450Val]
1475..1475 A/G rs139826001 + CDS Synonymous[Ser465Ser]
1522..1522 C/G rs180760747 + CDS Nonsynonymous[Pro481Arg]
1557..1557 C/A rs201433998 + CDS Nonsynonymous[Pro493Thr]
1559..1559 G/A rs2271750 + CDS Synonymous[Pro493Pro]
1594..1594 G/T rs199836327 + CDS Nonsynonymous[Cys505Phe]
1640..1640 C/G rs144695386 + CDS Synonymous[Thr520Thr]
1692..1692 G/A rs148511637 + CDS Nonsynonymous[Asp538Asn]
1700..1700 G/A rs192021632 + CDS Synonymous[Lys540Lys]
1701..1701 C/T rs151091903 + CDS Nonsynonymous[Pro541Ser]
1760..1760 G/A rs146156628 + CDS Synonymous[Lys560Lys]
1795..1795 A/G rs113864359 + CDS Nonsynonymous[His572Arg]
1840..1840 A/G rs140178180 + CDS Nonsynonymous[Tyr587Cys]
1866..1866 G/A/T rs138854677 + CDS
1915..1915 T/A rs151294867 + CDS Nonsynonymous[Leu612Gln]
1919..1919 G/A rs140230868 + CDS Synonymous[Ser613Ser]
1930..1930 A/G rs201364983 + CDS Nonsynonymous[Glu617Gly]
1947..1947 G/T rs11598673 + CDS Nonsynonymous[Ala623Ser]
1960..1960 A/G rs201390813 + CDS Nonsynonymous[Gln627Arg]
1973..1973 A/G rs144933488 + CDS Synonymous[Lys631Lys]
1990..1990 A/G rs191892747 + CDS Nonsynonymous[Gln637Arg]
2016..2016 A/G rs141961630 + CDS Nonsynonymous[Lys646Glu]
2046..2046 C/T rs145722717 + CDS Synonymous[Leu656Leu]
2089..2089 C/T rs138971174 + CDS Nonsynonymous[Ser670Leu]
2090..2090 G/A rs141435496 + CDS Synonymous[Ser670Ser]
2097..2097 G/A rs143564622 + CDS Nonsynonymous[Val673Ile]
2115..2115 T/G rs148029299 + CDS Nonsynonymous[Leu679Val]
2142..2142 A/G rs200695050 + CDS Nonsynonymous[Ile688Val]
2175..2175 G/A rs61751510 + CDS Nonsynonymous[Glu699Lys]
2189..2189 T/C rs150856565 + CDS Synonymous[Leu703Leu]
2278..2278 T/C rs138280588 + CDS Nonsynonymous[Ile733Thr]
2310..2310 G/A rs149539197 + CDS Nonsynonymous[Val744Met]
2324..2324 C/T rs201271419 + CDS Synonymous[Phe748Phe]
2340..2340 G/A rs142808362 + CDS Nonsynonymous[Gly754Arg]
2400..2400 G/C rs146059944 + CDS Nonsynonymous[Val774Leu]
2418..2418 G/T rs11591914 + CDS Nonsynonymous[Ala780Ser]
2419..2419 C/T rs145404572 + CDS Nonsynonymous[Ala780Val]
2424..2424 A/G rs200777243 + CDS Nonsynonymous[Lys782Glu]
2479..2479 C/T rs140197445 + CDS Nonsynonymous[Ser800Leu]
2540..2540 G/C rs143885184 + CDS Nonsynonymous[Glu820Asp]
2544..2544 C/T rs11191685 + CDS Synonymous[Leu822Leu]
2552..2552 C/T rs144821281 + CDS Synonymous[Gly824Gly]
2553..2553 G/A rs148565951 + CDS Nonsynonymous[Val825Met]
2594..2594 G/T rs200374616 + CDS Nonsynonymous[Gln838His]
2596..2596 C/T rs142899352 + CDS Nonsynonymous[Thr839Met]
2603..2603 C/T rs148098152 + CDS Synonymous[Ala841Ala]
2614..2614 C/T rs142052555 + CDS Nonsynonymous[Pro845Leu]
2628..2628 G/A rs144250771 + CDS Nonsynonymous[Asp850Asn]
2629..2629 A/G rs147765576 + CDS Nonsynonymous[Asp850Gly]
2639..2639 G/A rs113663830 + CDS Synonymous[Val853Val]
2690..2690 C/T rs141472462 + CDS Synonymous[Pro870Pro]
2694..2694 C/G rs150379700 + CDS Nonsynonymous[Leu872Val]
2710..2710 G/A rs199529671 + CDS Nonsynonymous[Ser877Asn]
2713..2713 G/C rs138071252 + CDS Nonsynonymous[Arg878Thr]
2723..2723 C/T rs149086019 + CDS Synonymous[Arg881Arg]
2776..2776 T/C rs61751511 + CDS Nonsynonymous[Val899Ala]
2801..2801 C/T rs183860702 + CDS Synonymous[His907His]
2836..2836 C/T rs201153613 + CDS Nonsynonymous[Ala919Val]
2859..2859 G/A rs202170736 + CDS Nonsynonymous[Glu927Lys]
2920..2920 C/T rs138371160 + CDS Nonsynonymous[Thr947Met]
2929..2929 T/C rs201352703 + CDS Nonsynonymous[Leu950Pro]
2937..2937 T/C rs199624392 + CDS Nonsynonymous[Phe953Leu]
2939..2939 C/T rs200516240 + CDS Synonymous[Phe953Phe]
2957..2957 C/A rs142836942 + CDS Synonymous[Leu959Leu]
2960..2960 C/T rs142048126 + CDS Synonymous[Asn960Asn]
2961..2961 G/A rs117992169 + CDS Nonsynonymous[Asp961Asn]
2970..2970 C/T rs111766494 + CDS Nonsynonymous[Arg964Cys]
2971..2971 G/A rs138821930 + CDS Nonsynonymous[Arg964His]
3070..3070 C/T rs146163208 + CDS Nonsynonymous[Pro997Leu]
3094..3094 C/T rs141400211 + CDS Nonsynonymous[Pro1005Leu]
3114..3114 A/T rs150905850 + CDS Nonsynonymous[Thr1012Ser]
3226..3226 C/T rs185014546 + CDS Nonsynonymous[Thr1049Ile]
3346..3346 C/T rs113363382 + CDS Nonsynonymous[Thr1089Ile]
3363..3363 G/A rs149624796 + CDS Nonsynonymous[Gly1095Arg]
3384..3384 A/G rs140189469 + CDS Nonsynonymous[Lys1102Glu]
3396..3396 A/G rs140429035 + CDS Nonsynonymous[Ile1106Val]
3413..3413 C/T rs144287622 + CDS Synonymous[Phe1111Phe]
3437..3437 T/A rs147787925 + CDS Nonsynonymous[Ser1119Arg]
3452..3452 G/A rs139477366 + CDS Synonymous[Glu1124Glu]
3476..3476 T/C rs142484346 + CDS Synonymous[Leu1132Leu]
3480..3480 A/G rs151021314 + CDS Nonsynonymous[Thr1134Ala]
3524..3524 C/T rs79997414 + CDS Synonymous[Ala1148Ala]
3530..3530 G/T rs140882275 + CDS Nonsynonymous[Gln1150His]
3604..3604 G/A rs61760969 + CDS Nonsynonymous[Arg1175Gln]
3618..3618 T/C rs146721855 + CDS Synonymous[Leu1180Leu]
3660..3660 G/C rs140323624 + CDS Nonsynonymous[Asp1194His]
3698..3698 C/T rs200479386 + CDS Synonymous[Thr1206Thr]
3726..3726 T/C rs2986014 + CDS Nonsynonymous[Phe1216Leu]
3800..3800 G/A rs187041040 + CDS Synonymous[Val1240Val]
3808..3808 A/G rs138842439 + CDS Nonsynonymous[Asn1243Ser]
3822..3822 G/A rs191877975 + CDS Nonsynonymous[Val1248Ile]
3884..3884 C/T rs201079225 + CDS Synonymous[Ser1268Ser]
3889..3889 C/T rs200115454 + CDS Nonsynonymous[Thr1270Met]
3932..3932 C/T rs201159426 + CDS Synonymous[Tyr1284Tyr]
3954..3954 G/A rs73330626 + CDS Nonsynonymous[Val1292Ile]
3967..3967 C/T rs200352557 + CDS Nonsynonymous[Ser1296Leu]
3968..3968 G/A rs199717141 + CDS Synonymous[Ser1296Ser]
3974..3974 A/G rs112018284 + CDS Synonymous[Arg1298Arg]
3997..3997 C/T rs200173780 + CDS Nonsynonymous[Thr1306Met]
4070..4070 T/C rs41287498 + CDS Synonymous[Tyr1330Tyr]
4073..4073 A/T rs199766677 + CDS Synonymous[Val1331Val]
4155..4155 C/A rs148179205 + CDS Nonsynonymous[His1359Asn]
4227..4227 C/T rs113940597 + CDS Nonsynonymous[Arg1383Cys]
4272..4272 G/A rs141994658 + CDS Nonsynonymous[Gly1398Arg]
4293..4293 G/A rs191321233 + CDS Nonsynonymous[Val1405Met]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;