H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000044006 Last modified: 27-May-2015
Definition: Steroidogenic factor 1; SF-1; STF-1; Adrenal 4-binding protein; Fushi tarazu factor homolog 1; Nuclear receptor subfamily 5 group A member 1; Steroid hormone receptor Ad4BP;
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000044006
Length 461
Codon Adaptation Index (CAI). 0.873
Database links RefSeq NA
UniProt Q13285 ;
CCDS Q13285;
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000041571
H-Inv cluster ID Locus view HIX0008372
Predicted CDS 188..1573 ; 461[aa] ; Orientation:+2 ;
Genomic location Chromosome 9
Location 9q33.3
CDS position 127243515-127269699
Strand -
Accession number BC032501.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:45252 IMAGE:5227690
Experimental resources NBRC: NITE Biological Resource Center NBRC     Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (NR5A1) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (NR5A1) ;
Length of cDNA 3119[bp] (No. of exon:7)[A:592 T:587 G:952 C:988] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2516 ;
KEGG GENES KEGG GENES(2516) ;
GeneCard GeneCard NR5A1 ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000041571
H-Inv cluster IDLocus view HIX0008372
Accession numberBC032501.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSteroidogenic factor 1; SF-1; STF-1; Adrenal 4-binding protein; Fushi tarazu factor homolog 1; Nuclear receptor subfamily 5 group A member 1; Steroid hormone receptor Ad4BP;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (Q13285) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help Representative H-Inv IDRepresentative transcript; Splicing isoformSplicing isoform;
Genomic Location G-integra Help Chromosome9
Location9q33.3
CDS position127243515-127269699
Strand-
Gene structure7 exons
No.2
H-Inv IDTranscript view HIT000221293
H-Inv cluster IDLocus view HIX0008372
Accession numberU76388.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSteroidogenic factor 1; SF-1; STF-1; Adrenal 4-binding protein; Fushi tarazu factor homolog 1; Nuclear receptor subfamily 5 group A member 1; Steroid hormone receptor Ad4BP;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (Q13285) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome9
Location9q33.3
CDS position127244543-127265689
Strand-
Gene structure6 exons
No.3
H-Inv IDTranscript view HIT000653609
H-Inv cluster IDLocus view HIX0008372
Accession numberHQ692856.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSteroidogenic factor 1; SF-1; STF-1; Adrenal 4-binding protein; Fushi tarazu factor homolog 1; Nuclear receptor subfamily 5 group A member 1; Steroid hormone receptor Ad4BP;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (Q13285) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome9
Location9q33.3
CDS position127245037-127265674
Strand-
Gene structure6 exons

Motif information in predicted CDS
ORF

length(462),orf(188:1573)
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCT
ESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYK
RDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVLPPSLHGPEPK
GLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEP
YASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQE
PTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLR
AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAA
LLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNN
LLIEMLQAKQT*
a.a.
length
InterPro Name
length(72), motif(10:81) 72IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(76), motif(10:85) 76IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(83), motif(11:93) 83IPR013088Zinc finger, NHR/GATA-type [Domain]
length(68), motif(12:79) 68IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(17), motif(13:29) 17IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(27), motif(13:39) 27IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(16), motif(29:44) 16IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(36), motif(59:94) 36IPR008946Nuclear hormone receptor, ligand-binding [Domain]
length(9), motif(62:70) 9IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(9), motif(70:78) 9IPR001628Zinc finger, nuclear hormone receptor-type [Domain]
length(11), motif(74:84) 11IPR001723Steroid hormone receptor [Family]
length(245), motif(216:460) 245IPR008946Nuclear hormone receptor, ligand-binding [Domain]
length(240), motif(220:459) 240IPR008946Nuclear hormone receptor, ligand-binding [Domain]
length(178), motif(259:436) 178IPR000536Nuclear hormone receptor, ligand-binding, core [Domain]
length(164), motif(267:430) 164IPR000536Nuclear hormone receptor, ligand-binding, core [Domain]
length(22), motif(268:289) 22IPR001723Steroid hormone receptor [Family]
length(17), motif(289:305) 17IPR001723Steroid hormone receptor [Family]
length(16), motif(361:376) 16IPR001723Steroid hormone receptor [Family]
length(18), motif(418:435) 18IPR001723Steroid hormone receptor [Family]

Protein function information
H-Inv protein ID HIP000044006
Representative H-Inv transcript ID Transcript view HIT000041571
H-Inv cluster ID Locus view HIX0008372
Definition Steroidogenic factor 1; SF-1; STF-1; Adrenal 4-binding protein; Fushi tarazu factor homolog 1; Nuclear receptor subfamily 5 group A member 1; Steroid hormone receptor Ad4BP;
Similarity category Help Identical to known human protein(Category I).
Identical to known human protein (Q13285) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction 51
Interaction partner(s) HIP000011562; HIP000012126; HIP000016421; HIP000021161; HIP000022018; HIP000022018; HIP000023088; HIP000023532; HIP000023532; HIP000023938; HIP000024008; HIP000024053; HIP000026159; HIP000028758; HIP000032682; HIP000036238; HIP000036688; HIP000039720; HIP000041928; HIP000043021; HIP000045875; HIP000046967; HIP000054110; HIP000059676; HIP000069396; HIP000072201; HIP000074788; HIP000075470; HIP000076639; HIP000080553; HIP000081588; HIP000086861; HIP000087965; HIP000090330; HIP000092109; HIP000093097; HIP000097326; HIP000100008; HIP000108912; HIP000111455; HIP000111574; HIP000120705; HIP000134607; HIP000134607; HIP000135015; HIP000168286; HIP000194592; HIP000205847; HIP000250623; HIP000346363; HIP000382070;
BIND NA
DIP 131625E; 131861E; 132126E; 132257E; 132350E;
MINT MINT-15668; MINT-15669; MINT-8111571; MINT-8112291;
HPRD 00286; 01239; 01302; 01496; 01793; 01796; 02437; 02740; 03330; 03440; 03688; 03927; 04070; 05214; 06427; 08362; 08921; 08928; 08994; 09235; 11647; 15889; 16029; 16175; 17871;
IntAct NA
Database links RefSeq NA
UniProt Q13285 ;
CCDS Q13285;
Gene symbol/name HGNC symbol NR5A1
HGNC aliases NA
HGNC name nuclear receptor subfamily 5, group A, member 1;
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT nuclear;
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified : 27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
12 87 1a6yA 4e-16 53.9 76/78 g.39.1.2
253 456 1ovlA 1e-28 18.8 197/228 a.123.1.1
Related H-InvDB links GTOP GTOP

Evolutionary information
Relationship Species Accession number MGI Links
Orthology Gallus sp. (Chicken) AB002404 G-integraG-integra
Orthology Oryzias sp. (Medaka) AB016834 G-integraG-integra
Orthology Danio sp. (Zebrafish) AF198086 G-integraG-integra
Orthology Mus sp. (Mouse) AK134378 MGI:3536103 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC124756 G-integraG-integra
Orthology Bos sp. (Cow) D13569 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000016541 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000022867 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00020031001 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00034373001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000132871 G-integraG-integra
Orthology Rattus sp. (Rat) XM_001055033 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001082881 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001371666 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_520248 G-integraG-integra
Orthology Canis sp. (Dog) XM_846937 G-integraG-integra
Phylogenetic tree [View by ATV] TNeighbor-joining (phb) 
Related H-InvDB links EvolaEvola dN/dS

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
190..190 G/A rs121918656 + CDS Nonsynonymous[Met1Ile]
198..198 C/T rs145936761 - CDS Nonsynonymous[Ser4Leu]
220..220 G/A rs142402038 - CDS Synonymous[Glu11Glu]
230..230 G/A rs104894124 + CDS Nonsynonymous[Val15Met]
235..235 C/A rs104894123 + CDS AA-STOP[Cys16*]
271..271 C/G rs139733398 - CDS Synonymous[Leu28Leu]
331..331 G/T rs201827533 - CDS Synonymous[Thr48Thr]
351..351 G/A rs184724257 - CDS Nonsynonymous[Cys55Tyr]
412..412 G/C rs138805488 - CDS Synonymous[Thr75Thr]
421..421 G/A rs104894125 + CDS Nonsynonymous[Met78Ile]
433..433 C/T rs200416930 - CDS Synonymous[Ala82Ala]
458..458 G/A rs104894126 + CDS Nonsynonymous[Gly91Ser]
462..462 G/A rs104894119 + CDS Nonsynonymous[Arg92Gln]
478..478 G/A rs200862223 - CDS Synonymous[Pro97Pro]
555..555 G/C rs200163795 - CDS Nonsynonymous[Gly123Ala]
562..562 G/A rs1110062 - CDS Synonymous[Pro125Pro]
573..573 C/T rs200749741 - CDS Nonsynonymous[Pro129Leu]
576..576 C/T rs201340156 - CDS Nonsynonymous[Pro130Leu]
624..624 G/C rs1110061 - CDS Nonsynonymous[Gly146Ala]
703..703 C/T rs113506523 - CDS Synonymous[Ala172Ala]
781..781 G/A rs142414614 - CDS Synonymous[Pro198Pro]
819..819 A/G rs201548212 - CDS Nonsynonymous[Tyr211Cys]
821..821 G/A rs201095702 - CDS Nonsynonymous[Gly212Ser]
826..826 C/A rs202111164 - CDS AA-STOP[Tyr213*]
854..854 G/A rs74535046 - CDS Nonsynonymous[Val223Met]
877..877 G/T rs111518201 - CDS Synonymous[Leu230Leu]
891..891 C/T rs199761539 - CDS Nonsynonymous[Pro235Leu]
951..951 G/T rs104894118 + CDS Nonsynonymous[Arg255Leu]
956..956 G/A rs141502483 - CDS Nonsynonymous[Asp257Asn]
963..963 C/T rs148356103 - CDS Nonsynonymous[Pro259Leu]
974..974 G/A rs143355429 - CDS Nonsynonymous[Gly263Ser]
1045..1045 C/T rs149583896 - CDS Synonymous[Phe286Phe]
1064..1064 G/A rs121918655 + CDS Nonsynonymous[Asp293Asn]
1074..1074 C/T rs201151141 - CDS Nonsynonymous[Thr296Met]
1096..1096 C/T rs185071408 - CDS Synonymous[Ser303Ser]
1099..1099 G/A rs138439339 - CDS Synonymous[Glu304Glu]
1129..1129 G/A rs201103618 - CDS Synonymous[Gln314Gln]
1138..1138 C/T rs147024762 - CDS Synonymous[His317His]
1168..1168 C/T/A rs141555967 - CDS
1253..1253 C/T rs147632907 - CDS Synonymous[Leu356Leu]
1287..1287 A/G rs76323457 - CDS Nonsynonymous[Glu367Gly]
1328..1328 T/G rs200939258 - CDS Nonsynonymous[Leu381Val]
1394..1394 G/A rs150382425 - CDS Nonsynonymous[Asp403Asn]
1453..1453 C/T rs140408680 - CDS Synonymous[Cys422Cys]
1467..1467 G/A rs151191539 - CDS Nonsynonymous[Arg427Gln]
1497..1497 T/A rs104894120 + CDS Nonsynonymous[Leu437Gln]
1501..1501 C/T rs142188133 - CDS Synonymous[Tyr438Tyr]
1540..1540 G/A rs79833327 - CDS Synonymous[Leu451Leu]
1566..1566 A/G/C rs146454575 - CDS
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;