H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000056725 Last modified: 27-May-2015
Definition: Probable G-protein coupled receptor 116; Precursor;
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000056725
Length 1360
Codon Adaptation Index (CAI). 0.748
Database links RefSeq NA
UniProt NA
CCDS NA
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000262118
H-Inv cluster ID Locus view HIX0005939
Predicted CDS 26..4108 ; 1360[aa] ; Orientation:+2 ;
Genomic location Chromosome 6
Location 6p12.3
CDS position 46820338-46882866
Strand -
Accession number BC066121.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:71511 IMAGE:5298732
Experimental resources NBRC: NITE Biological Resource Center NBRC   HGPD: Human Gene and Protein Database HGPD   Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (GPR116) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (GPR116) ;
Length of cDNA 5514[bp] (No. of exon:21)[A:1619 T:1516 G:1179 C:1200] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:221395 ;
KEGG GENES KEGG GENES(221395) ;
GeneCard GeneCard GPR116 ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000262118
H-Inv cluster IDLocus view HIX0005939
Accession numberBC066121.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionProbable G-protein coupled receptor 116; Precursor;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (Q8IZF2) [Identity/coverage = 99.851%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome6
Location6p12.3
CDS position46820338-46882866
Strand-
Gene structure21 exons

Motif information in predicted CDS
ORF

length(1361),orf(26:4108)
MGGSLEANQLKLEDMKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSL
HEHEPAGEEALRQKRAVATKSPTAEEYTVNIEISFENASFLDPIKAYLNS
LSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHN
LICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDL
MNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKT
TPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEG
DTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLT
IHNITPGDAGEYVCKLILDIFEYECKKKIDVMPIQILANEEMKVMCDNNP
VSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDIDSSCSRYTLKADGTQC
PSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPISVSEGQ
NFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTST
REWNGTYHCIFRYKNSYSIATKDVIVHPLPLKLNIMVDPLEATVSCSGSH
HIKCCIEEDGDYKVTFHMGSSSLPAAKEVNKKQVCYKHNFNASSVSWCSK
TVDVCCHFTNAANNSVWSPSMKLNLVPGENITCQDPVIGVGEPGKVIQKL
CRFSNVPSSPESPIGGTITYKCVGSQWEEKRNDCISAPINSLLQMAKALI
KSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSLGAIINILDLLSTVPTQ
VNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQAL
QSGDSPPLSFSQTNVQMSSTVIKSSHPETYQQRFVFPYFDLWGNVVIDKS
YLENLQSDSSIVTMAFPTLQAILAQDIQENNFAESLVMTTTVSHNTTMPF
RISMTFKNNSPSGGETKCVFWNFRLANNTGGWDSSGCYVEEGDGDNVTCI
CDHLTSFSILMSPDSPDPSSLLGILLDIISYVGVGFSILSLAACLVVEAV
VWKSVTKNRTSYMRHTCIVNIAASLLVANTWFIVVAAIQDNRYILCKTAC
VAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGY
GCPLAISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVN
ITITIVVITKILRPSIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGL
TTVFPGTNLVFHIIFAILNVFQGLFILLFGCLWDLKVQEALLNKFSLSRW
SSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKTGTYNVSTPEATSSSLE
NSSSASSLLN*
a.a.
length
InterPro Name
length(19), motif(74:92) 19IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(26), motif(153:178) 26IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(115), motif(182:296) 115IPR000082SEA domain [Domain]
length(96), motif(183:278) 96IPR000082SEA domain [Domain]
length(110), motif(184:293) 110IPR000082SEA domain [Domain]
length(86), motif(281:366) 86IPR007110Immunoglobulin-like domain [Domain]
length(84), motif(297:380) 84IPR013783Immunoglobulin-like fold [Domain]
length(74), motif(298:371) 74IPR003598Immunoglobulin subtype 2 [Domain]
length(68), motif(299:366) 68IPR013098Immunoglobulin I-set [Domain]
length(98), motif(383:480) 98IPR007110Immunoglobulin-like domain [Domain]
length(18), motif(390:407) 18IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(27), motif(412:438) 27IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(25), motif(441:465) 25IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(91), motif(485:575) 91IPR007110Immunoglobulin-like domain [Domain]
length(82), motif(487:568) 82IPR013783Immunoglobulin-like fold [Domain]
length(87), motif(491:577) 87IPR003599Immunoglobulin subtype [Domain]
length(22), motif(680:701) 22IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(14), motif(714:727) 14IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(53), motif(964:1016) 53IPR000203GPS motif [Domain]
length(47), motif(965:1011) 47IPR000203GPS motif [Domain]
length(52), motif(965:1016) 52IPR000203GPS motif [Domain]
length(251), motif(1026:1276) 251IPR000832GPCR, family 2, secretin-like [Family]
length(259), motif(1026:1284) 259IPR017981GPCR, family 2-like [Domain]
length(25), motif(1028:1052) 25IPR000832GPCR, family 2, secretin-like [Family]
length(13), motif(1052:1064) 13IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(24), motif(1102:1125) 24IPR000832GPCR, family 2, secretin-like [Family]
length(17), motif(1126:1142) 17IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(18), motif(1168:1185) 18IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(26), motif(1187:1212) 26IPR000832GPCR, family 2, secretin-like [Family]
length(18), motif(1213:1230) 18IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(21), motif(1231:1251) 21IPR000832GPCR, family 2, secretin-like [Family]
length(22), motif(1262:1283) 22IPR000832GPCR, family 2, secretin-like [Family]
length(16), motif(1272:1287) 16IPR017983GPCR, family 2, secretin-like, conserved site [Conserved_site]
length(27), motif(1286:1312) 27IPR008078GPCR, family 2, Ig-hepta receptor [Family]
length(25), motif(1314:1338) 25IPR008078GPCR, family 2, Ig-hepta receptor [Family]

Protein function information
H-Inv protein ID HIP000056725
Representative H-Inv transcript ID Transcript view HIT000262118
H-Inv cluster ID Locus view HIX0005939
Definition Probable G-protein coupled receptor 116; Precursor;
Similarity category Help Identical to known human protein(Category I).
Identical to known human protein (Q8IZF2) [Identity/coverage = 99.851%/100.0%] to Homo sapiens (Human). protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
UniProt NA
CCDS NA
Gene symbol/name HGNC symbol GPR116
HGNC aliases NA
HGNC name G protein-coupled receptor 116;
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT plasma membrane;
Target P Other
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified : 27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
185 288 1ivzA 7e-12 21.4 103/132 d.58.41.1
299 386 1olzA1 2e-06 16.7 79/91 b.1.1.4
487 580 2cqvA1 5e-08 15.2 92/101 b.1.1.4
Related H-InvDB links GTOP GTOP

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
55..55 C/G rs201268117 - CDS Synonymous[Leu10Leu]
107..107 A/G rs200005287 - CDS Nonsynonymous[Ile28Val]
149..149 G/A rs139944654 - CDS Nonsynonymous[Glu42Lys]
165..165 C/A rs201929281 - CDS Nonsynonymous[Pro47His]
199..199 A/G rs113814630 - CDS Synonymous[Glu58Glu]
212..212 C/A rs78296467 - CDS Nonsynonymous[Gln63Lys]
219..219 G/A rs138615507 - CDS Nonsynonymous[Arg65Gln]
222..222 C/T rs191044850 - CDS Nonsynonymous[Ala66Val]
223..223 C/T rs200874020 - CDS Synonymous[Ala66Ala]
224..224 G/A rs145334563 - CDS Nonsynonymous[Val67Ile]
239..239 C/T rs139856813 - CDS Nonsynonymous[Pro72Ser]
348..348 A/G rs147464998 - CDS Nonsynonymous[Asn108Ser]
362..362 A/G rs143107263 - CDS Nonsynonymous[Ile113Val]
367..367 C/T rs678312 + CDS Synonymous[Thr114Thr]
422..422 T/C rs143999232 - CDS Nonsynonymous[Trp133Arg]
424..424 G/C rs149511712 - CDS Nonsynonymous[Trp133Cys]
433..433 C/T rs138073254 - CDS Synonymous[Cys136Cys]
455..455 C/T rs145580781 - CDS Nonsynonymous[Arg144Trp]
463..463 G/A rs141885100 - CDS Synonymous[Arg146Arg]
491..491 C/T rs138516675 - CDS Nonsynonymous[Arg156Cys]
511..511 G/T/A rs144628829 - CDS
536..536 C/T rs199548486 - CDS Synonymous[Leu171Leu]
546..546 A/G rs115136473 - CDS Nonsynonymous[Asn174Ser]
548..548 G/A rs146789315 - CDS Nonsynonymous[Gly175Arg]
609..609 G/A rs150959951 - CDS Nonsynonymous[Gly195Asp]
615..615 A/G rs202119083 - CDS Nonsynonymous[Gln197Arg]
640..640 C/T rs143316442 - CDS Synonymous[Ser205Ser]
641..641 G/A rs149197213 - CDS Nonsynonymous[Ala206Thr]
679..679 G/A rs78333594 - CDS Synonymous[Ala218Ala]
688..688 G/A rs145639403 - CDS Synonymous[Lys221Lys]
694..694 C/T rs140241968 - CDS Synonymous[Tyr223Tyr]
695..695 G/A rs147874364 - CDS Nonsynonymous[Gly224Arg]
709..709 C/T rs200496823 - CDS Synonymous[Gly228Gly]
718..718 C/T rs202152357 - CDS Synonymous[Gly231Gly]
794..794 T/C rs144630403 - CDS Synonymous[Leu257Leu]
941..941 G/T rs192560047 - CDS Nonsynonymous[Val306Leu]
963..963 C/T rs201263107 - CDS Nonsynonymous[Ser313Phe]
981..981 G/A rs139730967 - CDS Nonsynonymous[Arg319His]
1036..1036 C/T rs150647239 - CDS Synonymous[Thr337Thr]
1059..1059 C/T rs199931272 - CDS Nonsynonymous[Ser345Leu]
1060..1060 G/A rs141718692 - CDS Synonymous[Ser345Ser]
1073..1073 A/C rs76658105 - CDS Nonsynonymous[Thr350Pro]
1076..1076 A/G rs202040944 - CDS Nonsynonymous[Ile351Val]
1085..1085 A/G rs199555725 - CDS Nonsynonymous[Ile354Val]
1091..1091 C/T rs148450798 - CDS Nonsynonymous[Pro356Ser]
1095..1095 G/T rs201468882 - CDS Nonsynonymous[Gly357Val]
1097..1097 G/A rs146250899 - CDS Nonsynonymous[Asp358Asn]
1104..1104 G/A rs200539613 - CDS Nonsynonymous[Gly360Asp]
1203..1203 A/T rs41273668 - CDS Nonsynonymous[Lys393Met]
1285..1285 G/A rs138779256 - CDS Synonymous[Gln420Gln]
1304..1304 C/A rs191079165 - CDS Nonsynonymous[Pro427Thr]
1311..1311 C/A rs144571563 - CDS Nonsynonymous[Thr429Asn]
1313..1313 C/G rs149458418 - CDS Nonsynonymous[Pro430Ala]
1359..1359 C/T rs77392151 - CDS Nonsynonymous[Ala445Val]
1371..1371 A/T rs201880878 - CDS Nonsynonymous[Gln449Leu]
1407..1407 A/G rs201798710 - CDS Nonsynonymous[Tyr461Cys]
1498..1498 G/A rs150327469 - CDS Synonymous[Pro491Pro]
1549..1549 T/C rs114116756 - CDS Synonymous[Ser508Ser]
1572..1572 T/C rs147719014 - CDS Nonsynonymous[Val516Ala]
1604..1604 T/C rs112491454 - CDS Nonsynonymous[Tyr527His]
1646..1646 G/A rs141815815 - CDS Nonsynonymous[Glu541Lys]
1661..1661 G/A rs199683187 - CDS Nonsynonymous[Val546Ile]
1699..1699 C/T rs199751206 - CDS Synonymous[His558His]
1717..1717 G/T rs147958492 - CDS Nonsynonymous[Lys564Asn]
1741..1741 A/G rs142259614 - CDS Synonymous[Lys572Lys]
1758..1758 C/G rs149143085 - CDS Nonsynonymous[Pro578Arg]
1759..1759 G/A rs145214557 - CDS Synonymous[Pro578Pro]
1775..1775 A/C rs202045429 - CDS Nonsynonymous[Asn584His]
1828..1828 C/T rs182260273 - CDS Synonymous[His601His]
1869..1869 C/T rs150003216 - CDS Nonsynonymous[Thr615Ile]
1878..1878 T/C rs586024 + CDS Nonsynonymous[Met618Thr]
1892..1892 C/T rs146239972 - CDS Nonsynonymous[Leu623Phe]
2023..2023 T/C rs614826 + CDS Synonymous[Val666Val]
2083..2083 C/T rs139946395 - CDS Synonymous[Pro686Pro]
2084..2084 G/A rs201326559 - CDS Nonsynonymous[Val687Ile]
2104..2104 G/A rs144652122 - CDS Synonymous[Pro693Pro]
2140..2140 C/T rs201435302 - CDS Synonymous[Asn705Asn]
2151..2151 G/C rs141610704 - CDS Nonsynonymous[Ser709Thr]
2166..2166 T/C rs147975526 - CDS Nonsynonymous[Ile714Thr]
2175..2175 C/G rs144467386 - CDS Nonsynonymous[Thr717Ser]
2201..2201 C/A rs199658359 - CDS Nonsynonymous[Gln726Lys]
2254..2254 C/G rs2273266 + CDS Synonymous[Leu743Leu]
2344..2344 G/A rs149269256 - CDS Synonymous[Ala773Ala]
2446..2446 G/A rs182227253 - CDS Synonymous[Thr807Thr]
2450..2450 G/A rs200270176 - CDS Nonsynonymous[Val809Met]
2468..2468 G/A rs9395218 - CDS Nonsynonymous[Val815Ile]
2470..2470 C/T rs200056704 - CDS Synonymous[Val815Val]
2479..2479 C/G rs12374606 - CDS Synonymous[Gly818Gly]
2481..2481 A/T rs147076717 - CDS Nonsynonymous[Lys819Met]
2572..2572 A/G rs180960579 - CDS Synonymous[Ala849Ala]
2573..2573 T/C rs12374645 - CDS Synonymous[Leu850Leu]
2579..2579 T/C rs141776519 - CDS Nonsynonymous[Ser852Pro]
2581..2581 A/G rs610856 + CDS Synonymous[Ser852Ser]
2612..2612 A/G rs200248669 - CDS Nonsynonymous[Thr863Ala]
2613..2613 C/T rs150267672 - CDS Nonsynonymous[Thr863Ile]
2621..2621 C/A rs201123540 - CDS Nonsynonymous[Gln866Lys]
2634..2634 C/T rs547499 + CDS Nonsynonymous[Thr870Met]
2687..2687 T/A rs201982496 - CDS Nonsynonymous[Tyr888Asn]
2728..2728 T/C rs9381487 - CDS Synonymous[Tyr901Tyr]
2751..2751 C/T rs200599117 - CDS Nonsynonymous[Ser909Leu]
2752..2752 G/A rs116032245 - CDS Synonymous[Ser909Ser]
2797..2797 T/C rs611779 + CDS Synonymous[Ala924Ala]
2826..2826 A/G rs146816496 - CDS Nonsynonymous[Glu934Gly]
2847..2847 C/T rs143344736 - CDS Nonsynonymous[Thr941Ile]
2863..2863 G/A rs571247 + CDS Synonymous[Thr946Thr]
2896..2896 G/A rs144073167 - CDS Synonymous[Lys957Lys]
2914..2914 C/T rs113672203 - CDS Synonymous[Gly963Gly]
2918..2918 G/A rs139221728 - CDS Nonsynonymous[Glu965Lys]
2942..2942 T/C rs201196893 - CDS Nonsynonymous[Phe973Leu]
2992..2992 T/A rs572248 + CDS Synonymous[Val989Val]
3004..3004 T/C rs141152676 - CDS Synonymous[Asp993Asp]
3006..3006 G/C rs138708426 - CDS Nonsynonymous[Gly994Ala]
3041..3041 T/A rs147171109 - CDS Nonsynonymous[Ser1006Thr]
3061..3061 C/T rs146902862 - CDS Synonymous[Ser1012Ser]
3138..3138 T/C rs143563991 - CDS Nonsynonymous[Ile1038Thr]
3199..3199 T/C rs613870 + CDS Synonymous[Asn1058Asn]
3200..3200 C/T rs200682859 - CDS Nonsynonymous[Arg1059Trp]
3216..3216 G/T rs199576297 - CDS Nonsynonymous[Arg1064Leu]
3238..3238 C/T rs151037028 - CDS Synonymous[Ile1071Ile]
3300..3300 G/A rs143364971 - CDS Nonsynonymous[Arg1092His]
3307..3307 A/G rs149215108 - CDS Nonsynonymous[Ile1094Met]
3314..3314 A/C rs138331843 - CDS Nonsynonymous[Lys1097Gln]
3388..3388 G/C rs150389766 - CDS Synonymous[Leu1121Leu]
3392..3392 C/T rs140532705 - CDS Nonsynonymous[Leu1123Phe]
3430..3430 A/G rs187141120 - CDS Synonymous[Glu1135Glu]
3496..3496 G/A rs142588297 - CDS Synonymous[Ser1157Ser]
3524..3524 C/T rs146806321 - CDS Nonsynonymous[Arg1167Trp]
3525..3525 G/A rs145046261 - CDS Nonsynonymous[Arg1167Gln]
3535..3535 T/C rs201301159 - CDS Synonymous[Tyr1170Tyr]
3537..3537 C/T rs141322343 - CDS Nonsynonymous[Thr1171Met]
3581..3581 C/T rs150981453 - CDS Synonymous[Leu1186Leu]
3586..3586 G/T rs142622587 - CDS Synonymous[Leu1187Leu]
3685..3685 A/G rs148469784 - CDS Synonymous[Pro1220Pro]
3729..3729 T/C rs145650405 - CDS Nonsynonymous[Ile1235Thr]
3730..3730 T/G/C rs182572299 - CDS
3790..3790 A/G rs202208960 - CDS Synonymous[Pro1255Pro]
3868..3868 C/T rs60479672 - CDS Synonymous[Cys1281Cys]
3878..3878 C/A rs199895998 - CDS Nonsynonymous[Leu1285Met]
3909..3909 T/C rs112842147 - CDS Nonsynonymous[Phe1295Ser]
3969..3969 C/T rs201216000 - CDS Nonsynonymous[Pro1315Leu]
4032..4032 C/T rs140284327 - CDS Nonsynonymous[Thr1336Met]
4068..4068 C/T rs147148177 - CDS Nonsynonymous[Ser1348Phe]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;