H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000089004 Last modified: 27-May-2015
Definition: Rho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15;
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000089004
Length 475
Codon Adaptation Index (CAI). 0.727
Database links RefSeq NA
UniProt Q53QZ3 ;
CCDS Q53QZ3;
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000333935
H-Inv cluster ID Locus view HIX0017957
Predicted CDS 118..1545 ; 475[aa] ; Orientation:+1 ;
Genomic location Chromosome 2
Location 2q22.2-2q22.3
CDS position 143886933-144525917
Strand +
Accession number BC038976.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:4104470
Experimental resources NBRC: NITE Biological Resource Center NBRC     Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ARHGAP15) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ARHGAP15) ;
Length of cDNA 1752[bp] (No. of exon:14)[A:619 T:441 G:350 C:342] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard GeneCard ARHGAP15 ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000052101
H-Inv cluster IDLocus view HIX0017957
Accession numberBC038976.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionRho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (Q53QZ3) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome2
Location2q22.2-2q22.3
CDS position143887005-144525921
Strand+
Gene structure14 exons
No.2
H-Inv IDTranscript view HIT000333935
H-Inv cluster IDLocus view HIX0017957
Accession numberBC029346.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionRho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (Q53QZ3) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help Representative H-Inv IDRepresentative transcript;
Genomic Location G-integra Help Chromosome2
Location2q22.2-2q22.3
CDS position143886933-144525917
Strand+
Gene structure14 exons

Motif information in predicted CDS
ORF

length(476),orf(118:1545)
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVG
KVTEPISRHRRNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRK
NWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDLCGAHIEWAKEK
SSRKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSR
NLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNR
VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHV
VTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPP
PNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAI
HMVYQNQIAELMLSEYSKIFGSEED*
a.a.
length
InterPro Name
length(473), motif(1:473) 473IPR015767Rho GTPase activating protein [Family]
length(111), motif(79:189) 111IPR001849Pleckstrin homology domain [Domain]
length(109), motif(80:188) 109IPR001849Pleckstrin homology domain [Domain]
length(112), motif(80:191) 112IPR001849Pleckstrin homology domain [Domain]
length(113), motif(80:192) 113IPR011993Pleckstrin homology-like domain [Domain]
length(209), motif(263:471) 209IPR000198Rho GTPase-activating protein domain [Domain]
length(194), motif(277:470) 194IPR008936Rho GTPase activation protein [Domain]
length(190), motif(281:470) 190IPR000198Rho GTPase-activating protein domain [Domain]
length(176), motif(292:467) 176IPR000198Rho GTPase-activating protein domain [Domain]
length(150), motif(295:444) 150IPR000198Rho GTPase-activating protein domain [Domain]

Protein function information
H-Inv protein ID HIP000089004
Representative H-Inv transcript ID Transcript view HIT000333935
H-Inv cluster ID Locus view HIX0017957
Definition Rho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15;
Similarity category Help Identical to known human protein(Category I).
Identical to known human protein (Q53QZ3) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction 1
Interaction partner(s) HIP000207868;
BIND 209089;
DIP NA
MINT MINT-19382; MINT-19392;
HPRD 00396; 01453; 01822; 06902;
IntAct NA
Database links RefSeq NA
UniProt Q53QZ3 ;
CCDS Q53QZ3;
Gene symbol/name HGNC symbol ARHGAP15
HGNC aliases NA
HGNC name Rho GTPase activating protein 15;
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT nuclear;
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified : 27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
78 193 1dynA 1e-10 12.5 112/113 b.55.1.1
277 470 1xa6A1 4e-45 32.0 194/196 a.116.1.1
Related H-InvDB links GTOP GTOP

Evolutionary information
Relationship Species Accession number MGI Links
Orthology Gallus sp. (Chicken) AJ719361 G-integraG-integra
Orthology Mus sp. (Mouse) AK040796 G-integraG-integra
Orthology Rattus sp. (Rat) BC079103 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000090052 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000012744 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000010876 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00015207001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000156434 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000183573 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001092308 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_001157299 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001364610 G-integraG-integra
Orthology Canis sp. (Dog) XM_533345 G-integraG-integra
Orthology Bos sp. (Cow) XR_027481 G-integraG-integra
Phylogenetic tree [View by ATV] TNeighbor-joining (phb) 
Related H-InvDB links EvolaEvola dN/dS

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
126..126 A/G rs142436201 + CDS Synonymous[Lys3Lys]
147..147 C/T rs140220849 + CDS Synonymous[Ser10Ser]
148..148 G/A rs140767178 + CDS Nonsynonymous[Val11Met]
169..169 C/T rs150127285 + CDS Nonsynonymous[Arg18Cys]
208..208 G/C rs77091978 + CDS Nonsynonymous[Ala31Pro]
261..261 T/C rs146989390 + CDS Synonymous[Asp48Asp]
302..302 A/G rs149299444 + CDS Nonsynonymous[Asn62Ser]
314..314 A/G rs77631323 + CDS Nonsynonymous[His66Arg]
327..327 T/C rs142961157 + CDS Synonymous[Asp70Asp]
391..391 G/A rs201268929 + CDS Nonsynonymous[Ala92Thr]
392..392 C/T rs147452927 + CDS Nonsynonymous[Ala92Val]
472..472 G/A rs138543005 + CDS Nonsynonymous[Glu119Lys]
479..479 A/G rs150643555 + CDS Nonsynonymous[Lys121Arg]
484..484 C/G rs149831189 + CDS Nonsynonymous[Gln123Glu]
498..498 T/C rs200527953 + CDS Synonymous[Asn127Asn]
663..663 C/T rs146868356 + CDS Synonymous[His182His]
682..682 G/C rs144541020 + CDS Nonsynonymous[Asp189His]
714..714 A/T rs199632589 + CDS Synonymous[Ser199Ser]
774..774 C/T rs17230746 + CDS Synonymous[Tyr219Tyr]
855..855 C/T rs200906734 + CDS Synonymous[Ser246Ser]
859..859 A/G rs140266263 + CDS Nonsynonymous[Lys248Glu]
898..898 C/T rs141398032 + CDS AA-STOP[Arg261*]
957..957 C/T rs147986323 + CDS Synonymous[Gly280Gly]
966..966 G/C rs138143506 + CDS Synonymous[Leu283Leu]
986..986 A/G rs199912817 + CDS Nonsynonymous[Glu290Gly]
1027..1027 G/A rs188001946 + CDS Nonsynonymous[Ala304Thr]
1094..1094 A/G rs111540259 + CDS Nonsynonymous[Gln326Arg]
1140..1140 C/T rs138120208 + CDS Synonymous[Asp341Asp]
1173..1173 C/G rs149563619 + CDS Synonymous[Thr352Thr]
1255..1255 A/G rs201853612 + CDS Nonsynonymous[Lys380Glu]
1277..1277 G/T rs141487481 + CDS Nonsynonymous[Arg387Ile]
1316..1316 C/T rs201019600 + CDS Nonsynonymous[Pro400Leu]
1324..1324 C/T rs200956271 + CDS Nonsynonymous[Arg403Cys]
1347..1347 T/C rs146358621 + CDS Synonymous[Phe410Phe]
1349..1349 G/A rs113815280 + CDS Nonsynonymous[Gly411Glu]
1358..1358 C/G rs199902781 + CDS Nonsynonymous[Thr414Ser]
1377..1377 C/T rs200435567 + CDS Synonymous[Ala420Ala]
1391..1391 T/C rs200952708 + CDS Nonsynonymous[Met425Thr]
1398..1398 G/A rs139437131 + CDS Synonymous[Thr427Thr]
1404..1404 C/T rs202023552 + CDS Synonymous[Ser429Ser]
1429..1429 C/T rs11538443 - CDS Nonsynonymous[Leu438Phe]
1486..1486 C/A rs145493919 + CDS Nonsynonymous[Gln457Lys]
1528..1528 G/A rs147613962 + CDS Nonsynonymous[Gly471Ser]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;