H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000102215 Last modified: 27-May-2015
Definition: Similar to Zinc finger protein 638; Cutaneous T-cell lymphoma-associated antigen se33-1; CTCL-associated antigen se33-1; Nuclear protein 220; Zinc finger matrin-like protein;
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000102215
Length 482
Codon Adaptation Index (CAI). 0.721
Database links RefSeq NA
UniProt NA
CCDS NA
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000261449
H-Inv cluster ID Locus view HIX0002151
Predicted CDS 48..1494 ; 482[aa] ; Orientation:+3 ;
Genomic location Chromosome 2
Location 2p13.2
CDS position 71576038-71590321
Strand +
Accession number BC064530.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:5587095
Experimental resources NBRC: NITE Biological Resource Center NBRC      
Length of cDNA 1494[bp] (No. of exon:3)[A:481 T:387 G:305 C:321] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:27332 ;
KEGG GENES KEGG GENES(27332) ;
GeneCard GeneCard NA
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000261449
H-Inv cluster IDLocus view HIX0002151
Accession numberBC064530.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSimilar to Zinc finger protein 638; Cutaneous T-cell lymphoma-associated antigen se33-1; CTCL-associated antigen se33-1; Nuclear protein 220; Zinc finger matrin-like protein;
Similarity category HelpSimilar to known protein(Category II).
Similar to known protein (Q14966) [Identity/coverage = 99.17%/24.37%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome2
Location2p13.2
CDS position71576038-71590321
Strand+
Gene structure3 exons

Motif information in predicted CDS
ORF

length(482),orf(48:1494)
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARG
IPHRFAGHESYQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPH
GSRWDDEPHISASVAVKQSSVTQVTEQSPKVQSRYTKESASSILASFGLS
NEDLEELSRYPDEQLTPENMPLILRDIRMRKMGRRLPNLPSQSRNKETLG
SEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVENEFQSQQNISA
SVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQER
IPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHAD
AQKMKRLPTPSMMNDYYAASPRIFPHLCSLCNVECSHLKDWIQHQNTSTH
IESCRQLRQQYPDWNPEILPSRRNEGNRKKKK
a.a.
length
InterPro Name
length(25), motif(426:450) 25IPR015880Zinc finger, C2H2-like [Domain]

Protein function information
H-Inv protein ID HIP000102215
Representative H-Inv transcript ID Transcript view HIT000261449
H-Inv cluster ID Locus view HIX0002151
Definition Similar to Zinc finger protein 638; Cutaneous T-cell lymphoma-associated antigen se33-1; CTCL-associated antigen se33-1; Nuclear protein 220; Zinc finger matrin-like protein;
Similarity category Help Similar to known protein(Category II).
Similar to known protein (Q14966) [Identity/coverage = 99.17%/24.37%] to Homo sapiens (Human). protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
UniProt NA
CCDS NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT nuclear;
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
73..73 G/A rs202042555 + CDS Nonsynonymous[Arg9Gln]
87..87 C/T rs143340083 + CDS Nonsynonymous[Leu14Phe]
126..126 C/T rs61344341 + CDS Nonsynonymous[Pro27Ser]
135..135 C/T rs148746042 + CDS Nonsynonymous[Pro30Ser]
148..148 C/A rs141395815 + CDS Nonsynonymous[Pro34His]
156..156 A/G rs139959335 + CDS Nonsynonymous[Met37Val]
180..180 G/T rs146722075 + CDS Nonsynonymous[Ala45Ser]
183..183 G/- rs35601433 + CDS
192..192 C/T rs149932567 + CDS Nonsynonymous[Arg49Cys]
195^196 -/G rs35950410 + CDS
272..272 A/G rs142437672 + CDS Synonymous[Gln75Gln]
280..280 C/G rs201231738 + CDS Nonsynonymous[Thr78Ser]
355..355 G/A rs145739027 + CDS Nonsynonymous[Arg103Gln]
375..375 A/G rs12612365 + CDS Nonsynonymous[Ile110Val]
376..376 T/C rs199581978 + CDS Nonsynonymous[Ile110Thr]
381..381 G/T rs147124716 + CDS Nonsynonymous[Ala112Ser]
408..408 G/C rs200279719 + CDS Nonsynonymous[Val121Leu]
437..437 A/G rs201188979 + CDS Synonymous[Lys130Lys]
438..438 G/T rs201124084 + CDS Nonsynonymous[Val131Leu]
455..455 A/G rs186891171 + CDS Synonymous[Thr136Thr]
509..509 A/G rs192501942 + CDS Synonymous[Leu154Leu]
522..522 C/T rs150249098 + CDS Nonsynonymous[Arg159Cys]
597..597 C/T rs138776273 + CDS Nonsynonymous[Arg184Cys]
698..698 T/C rs146296595 + CDS Synonymous[Tyr217Tyr]
761..761 C/T rs113179624 + CDS Synonymous[Val238Val]
769..769 A/C rs117125782 + CDS Nonsynonymous[Glu241Ala]
816..816 G/A rs185707555 + CDS Nonsynonymous[Val257Met]
831..831 A/G rs141845828 + CDS Nonsynonymous[Met262Val]
848..848 C/T rs199820298 + CDS Synonymous[Asp267Asp]
872..872 C/T rs148484922 + CDS Synonymous[Pro275Pro]
885..885 A/G rs150990011 + CDS Nonsynonymous[Asn280Asp]
912..912 A/T rs147769180 + CDS Nonsynonymous[Ser289Cys]
926..926 G/A rs141176451 + CDS Nonsynonymous[Met293Ile]
936..936 C/T rs202077297 + CDS Nonsynonymous[His297Tyr]
959..959 C/T rs145388354 + CDS Synonymous[Val304Val]
970..970 T/C rs201839539 + CDS Nonsynonymous[Ile308Thr]
978..978 G/A rs143329395 + CDS Nonsynonymous[Val311Ile]
990..990 A/G rs139900748 + CDS Nonsynonymous[Ile315Val]
1011..1011 A/C rs2160780 + CDS Nonsynonymous[Thr322Pro]
1052..1052 A/G rs199581220 + CDS Synonymous[Gln335Gln]
1060..1060 C/T rs201306909 + CDS Nonsynonymous[Ser338Leu]
1063..1063 C/T rs200383884 + CDS Nonsynonymous[Ser339Leu]
1093..1093 A/G rs113479982 + CDS Nonsynonymous[Glu349Gly]
1105..1105 A/G rs138325312 + CDS Nonsynonymous[His353Arg]
1124..1124 A/G rs150619658 + CDS Synonymous[Ser359Ser]
1128..1128 A/G rs199650109 + CDS Nonsynonymous[Asn361Asp]
1130..1130 C/T rs143507454 + CDS Synonymous[Asn361Asn]
1135..1135 A/C rs151209971 + CDS Nonsynonymous[His363Pro]
1139..1139 T/C rs112707279 + CDS Synonymous[Val364Val]
1176..1176 G/A rs147367833 + CDS Nonsynonymous[Ala377Thr]
1182..1182 A/G rs144997139 + CDS Nonsynonymous[Ile379Val]
1230..1230 A/G rs190073602 + CDS Nonsynonymous[Lys395Glu]
1248..1248 G/T rs192912662 + CDS Nonsynonymous[Ala401Ser]
1258..1258 T/G rs141088778 + CDS Nonsynonymous[Met404Arg]
1298..1298 T/C rs202045042 + CDS Synonymous[Tyr417Tyr]
1301..1301 A/G rs145810685 + CDS Synonymous[Ala418Ala]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;