H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000111855 Last modified: 27-May-2015
Definition: Similar to Abelson tyrosine-protein kinase 2 isoform g.
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000111855
Length 1167
Codon Adaptation Index (CAI). 0.756
Database links RefSeq NA
UniProt NA
CCDS
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000262090
H-Inv cluster ID Locus view HIX0001374
Predicted CDS 13..3516 ; 1167[aa] ; Orientation:+1 ;
Genomic location Chromosome 1
Location 1q25.2
CDS position 179076735-179112191
Strand -
Accession number BC065912.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:70756 IMAGE:5173213
Experimental resources NBRC: NITE Biological Resource Center NBRC   HGPD: Human Gene and Protein Database HGPD   Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ABL2) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ABL2) ;
Length of cDNA 3700[bp] (No. of exon:12)[A:1054 T:801 G:937 C:908] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:27 ;
KEGG GENES KEGG GENES(27) ;
GeneCard GeneCard ABL2 ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000262090
H-Inv cluster IDLocus view HIX0001374
Accession numberBC065912.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSimilar to Abelson tyrosine-protein kinase 2 isoform g.
Similarity category HelpSimilar to known protein(Category II).
Similar to known protein (NP_001161709) [Identity/coverage = 99.602%/93.23%] to Homo sapiens protein.
Transcript feature Help Splicing isoformSplicing isoform;
Genomic Location G-integra Help Chromosome1
Location1q25.2
CDS position179076735-179112191
Strand-
Gene structure12 exons

Motif information in predicted CDS
ORF

length(1168),orf(13:3516)
MVLGTVLLPPNSYGRDQDTSLCCLCTEASESALPDLTDHFASCVEDGFEG
DKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVAL
YDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPV
NSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEG
RVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPK
CNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVA
VKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMP
YGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNC
LVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIK
SDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVY
ELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSV
VPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQ
ASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTP
PKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPP
KCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRA
GKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERT
VSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTP
SGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPS
PAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQ
VTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQST
SETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGT
KVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQ
LLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPV
LNNLLSCVQEISDVVQR*
a.a.
length
InterPro Name
length(61), motif(92:152) 61IPR001452SH3 domain [Domain]
length(86), motif(93:178) 86IPR001452SH3 domain [Domain]
length(57), motif(95:151) 57IPR001452SH3 domain [Domain]
length(47), motif(98:144) 47IPR001452SH3 domain [Domain]
length(120), motif(150:269) 120IPR000980SH2 domain [Domain]
length(141), motif(153:293) 141IPR000980SH2 domain [Domain]
length(84), motif(156:239) 84IPR000980SH2 domain [Domain]
length(15), motif(158:172) 15IPR000980SH2 domain [Domain]
length(76), motif(158:233) 76IPR000980SH2 domain [Domain]
length(91), motif(158:248) 91IPR000980SH2 domain [Domain]
length(11), motif(177:187) 11IPR000980SH2 domain [Domain]
length(12), motif(189:200) 12IPR000980SH2 domain [Domain]
length(11), motif(201:211) 11IPR000980SH2 domain [Domain]
length(15), motif(222:236) 15IPR000980SH2 domain [Domain]
length(273), motif(264:536) 273IPR011009Protein kinase-like domain [Domain]
length(251), motif(273:523) 251IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(252), motif(273:524) 252IPR000719Protein kinase domain [Domain]
length(252), motif(273:524) 252IPR020635Tyrosine-protein kinase, catalytic domain [Domain]
length(24), motif(279:302) 24IPR017441Protein kinase, ATP binding site [Binding_site]
length(14), motif(346:359) 14IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(19), motif(384:402) 19IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(13), motif(390:402) 13IPR008266Tyrosine-protein kinase, active site [Active_site]
length(11), motif(432:442) 11IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(23), motif(451:473) 23IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(23), motif(495:517) 23IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(122), motif(1046:1167) 122IPR015015F-actin binding [Domain]
length(103), motif(1065:1167) 103IPR015015F-actin binding [Domain]

Protein function information
H-Inv protein ID HIP000111855
Representative H-Inv transcript ID Transcript view HIT000262090
H-Inv cluster ID Locus view HIX0001374
Definition Similar to Abelson tyrosine-protein kinase 2 isoform g.
Similarity category Help Similar to known protein(Category II).
Similar to known protein (NP_001161709) [Identity/coverage = 99.602%/93.23%] to Homo sapiens protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number EC 2.7.10.2 non-specific protein-tyrosine kinase
KEGG metabolic pathway 04020 Calcium signaling pathway 04360 Axon guidance 04370 VEGF signaling pathway 04510 Focal adhesion 04520 Adherens junction 04530 Tight junction 04540 Gap junction 04630 Jak-STAT signaling pathway 04660 T cell receptor signaling pathway 04662 B cell receptor signaling pathway 04664 Fc epsilon RI signaling pathway 04670 Leukocyte transendothelial migration 04730 Long-term depression 04810 Regulation of actin cytoskeleton 04912 GnRH signaling pathway 04920 Adipocytokine signaling pathway 05120 Epithelial cell signaling in Helicobacter pylori infection 05130 Pathogenic Escherichia coli infection - EHEC 05131 Pathogenic Escherichia coli infection - EPEC
Protein-protein interaction (PPI) PPI viewer No. of interaction 10
Interaction partner(s) HIP000028444; HIP000028444; HIP000037309; HIP000037309; HIP000054177; HIP000059105; HIP000087997; HIP000104670; HIP000125446; HIP000192588;
BIND 177272; 258877; 258878; 58089; 58130;
DIP 131587E; 131654E; 131745E; 131763E; 131975E; 132216E; 132385E; 288E; 58813E;
MINT MINT-59458; MINT-59459; MINT-59461; MINT-59462; MINT-7041692; MINT-74432; MINT-74433; MINT-74434; MINT-74435; MINT-74436; MINT-74437; MINT-74438; MINT-74439; MINT-74440; MINT-74441; MINT-74442; MINT-74443; MINT-74444; MINT-74445; MINT-74446; MINT-74447; MINT-74448; MINT-74449; MINT-74450; MINT-74451; MINT-74452; MINT-74453; MINT-74454; MINT-74455; MINT-74456; MINT-74457; MINT-74458; MINT-7908314; MINT-7908442; MINT-8034736; MINT-8110899; MINT-8111655; MINT-8112351; MINT-8112867;
HPRD 00579; 00796; 01281; 01398; 01809; 01819; 01820; 02533; 02740; 02767; 05142; 05813; 07338; 09352; 14381;
IntAct NA
Database links RefSeq NA
UniProt
CCDS
Gene symbol/name HGNC symbol ABL2
HGNC aliases "v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)", "v-abl Abelson murine leukemia viral oncogene homolog 2", "c-abl oncogene 2, non-receptor tyrosine kinase";
HGNC name ABL proto-oncogene 2, non-receptor tyrosine kinase;
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT nuclear;
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified : 27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
95 152 1aboA 2e-16 91.4 58/58 b.34.2.1
185 534 1nw1A 2e-59 8.9 349/365 d.144.1.8
Related H-InvDB links GTOP GTOP

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
21..21 T/C rs200931513 - CDS Synonymous[Leu3Leu]
24..24 G/A rs200959542 - CDS Synonymous[Gly4Gly]
47..47 G/C rs1318056 - CDS Nonsynonymous[Ser12Thr]
79..79 T/A rs201683367 - CDS Nonsynonymous[Cys23Ser]
82..82 C/A rs202125612 - CDS Nonsynonymous[Leu24Met]
175..175 G/A rs140292380 - CDS Nonsynonymous[Gly55Ser]
200..200 G/A rs55655202 - CDS Nonsynonymous[Arg63His]
206..206 A/G rs140935116 - CDS Nonsynonymous[Tyr65Cys]
259..259 A/G rs201376490 - CDS Nonsynonymous[Lys83Glu]
273..273 C/T rs200064313 - CDS Synonymous[Leu87Leu]
274..274 G/A rs187540054 - CDS Nonsynonymous[Gly88Arg]
303..303 C/T rs200298102 - CDS Synonymous[Phe97Phe]
304..304 G/A rs201168871 - CDS Nonsynonymous[Val98Ile]
347..347 G/A rs147306941 - CDS Nonsynonymous[Ser112Asn]
413..413 G/A rs148596386 - CDS Nonsynonymous[Arg134His]
431..431 G/T rs61821670 - CDS Nonsynonymous[Gly140Val]
476^477 -/A rs35945588 - CDS
511..511 G/A rs149352120 - CDS Nonsynonymous[Ala167Thr]
617..617 T/C rs112007604 - CDS Nonsynonymous[Val202Ala]
618..618 A/G rs28914528 + CDS Synonymous[Val202Val]
843..843 C/T rs180770623 - CDS Synonymous[His277His]
855..855 C/T rs201235188 - CDS Synonymous[Gly281Gly]
876..876 C/T rs56032037 - CDS Synonymous[Tyr288Tyr]
883..883 G/A rs200847097 - CDS Nonsynonymous[Val291Ile]
906..906 A/G rs28914532 + CDS Synonymous[Thr298Thr]
922..922 T/C rs28914533 + CDS Synonymous[Leu304Leu]
980..980 A/G rs192943572 - CDS Nonsynonymous[Glu323Gly]
999..999 G/A rs143159520 - CDS Synonymous[Leu329Leu]
1037..1037 T/G rs147552979 - CDS Nonsynonymous[Phe342Cys]
1050..1050 T/G rs150181582 - CDS Synonymous[Thr346Thr]
1053..1053 A/G rs139334603 - CDS Synonymous[Glu347Glu]
1073..1073 T/A rs141559171 - CDS AA-STOP[Leu354*]
1107..1107 G/A rs199688019 - CDS Synonymous[Glu365Glu]
1137..1137 C/T rs201521779 - CDS Synonymous[Ala375Ala]
1264..1264 T/C rs140036159 - CDS Synonymous[Leu418Leu]
1284..1284 T/C rs142746259 - CDS Synonymous[Tyr424Tyr]
1369..1369 G/A rs144729350 - CDS Nonsynonymous[Val453Ile]
1431..1431 T/C rs138565389 - CDS Synonymous[Gly473Gly]
1461..1461 A/C rs2274230 + CDS Synonymous[Leu483Leu]
1598..1598 A/G rs146942033 - CDS Nonsynonymous[His529Arg]
1644..1644 C/T rs151170340 - CDS Synonymous[Ala544Ala]
1787..1787 C/T rs185583542 - CDS Nonsynonymous[Ala592Val]
1789..1789 C/T rs148985886 - CDS Nonsynonymous[Pro593Ser]
1893..1893 A/G rs144233543 - CDS Synonymous[Thr627Thr]
1928..1928 G/C rs199575608 - CDS Nonsynonymous[Ser639Thr]
1957..1957 A/G rs141450341 - CDS Nonsynonymous[Thr649Ala]
1960..1960 C/A rs144066805 - CDS Nonsynonymous[Pro650Thr]
1965..1965 C/T rs138240636 - CDS Synonymous[Pro651Pro]
2016..2016 C/T rs146997813 - CDS Synonymous[Tyr668Tyr]
2024..2024 C/T rs200298510 - CDS Nonsynonymous[Thr671Met]
2025..2025 G/T rs28913887 + CDS Synonymous[Thr671Thr]
2054..2054 A/G rs150953979 - CDS Nonsynonymous[Gln681Arg]
2084..2084 C/A rs143839622 - CDS Nonsynonymous[Ala691Asp]
2126^2127 -/G rs67764190 - CDS
2157..2157 C/T rs28913888 + CDS Synonymous[Asp715Asp]
2160..2160 C/T rs144460998 - CDS Synonymous[Asp716Asp]
2161..2161 G/A rs148512062 - CDS Nonsynonymous[Gly717Ser]
2169..2169 G/T rs139820193 - CDS Synonymous[Gly719Gly]
2203..2203 T/G rs78418476 - CDS Nonsynonymous[Ser731Ala]
2205..2205 T/C rs147272038 - CDS Synonymous[Ser731Ser]
2231..2231 G/A rs147435995 - CDS Nonsynonymous[Arg740His]
2241..2241 A/G rs202245355 - CDS Synonymous[Lys743Lys]
2248..2248 C/T rs140267087 - CDS Synonymous[Leu746Leu]
2317..2317 A/T rs55892721 - CDS Nonsynonymous[Thr769Ser]
2474..2474 A/T rs146696301 - CDS Nonsynonymous[Lys821Ile]
2481..2481 G/A rs138005479 - CDS Synonymous[Glu823Glu]
2592..2592 C/T rs61731092 - CDS Synonymous[Asp860Asp]
2633..2633 A/- rs34839060 - CDS
2680..2680 C/A rs201832781 - CDS Nonsynonymous[Pro890Thr]
2689..2689 G/A rs145907038 - CDS Nonsynonymous[Gly893Arg]
2701..2701 G/T rs140629135 - CDS Nonsynonymous[Gly897Cys]
2743..2743 A/T rs202035355 - CDS Nonsynonymous[Thr911Ser]
2756..2756 A/G rs17277288 - CDS Nonsynonymous[Lys915Arg]
2783..2783 T/G rs201190336 - CDS Nonsynonymous[Leu924Arg]
2803..2803 G/A rs28913889 + CDS Nonsynonymous[Val931Met]
2811..2811 C/T rs35124879 - CDS Synonymous[Leu933Leu]
2816..2816 G/T rs181288208 - CDS Nonsynonymous[Gly935Val]
2851..2851 T/C rs150587634 - CDS Nonsynonymous[Ser947Pro]
2897..2897 G/A rs137859710 - CDS Nonsynonymous[Arg962Gln]
2954..2954 C/G rs28913890 + CDS Nonsynonymous[Pro981Arg]
2955..2955 G/C rs150940806 - CDS Synonymous[Pro981Pro]
2982..2982 G/A rs145868471 - CDS Synonymous[Glu990Glu]
2986..2986 A/G rs140945067 - CDS Nonsynonymous[Thr992Ala]
3032..3032 G/A rs201697670 - CDS Nonsynonymous[Gly1007Glu]
3056..3056 T/C rs140016842 - CDS Nonsynonymous[Val1015Ala]
3123..3123 C/A rs147901436 - CDS Synonymous[Ser1037Ser]
3129..3129 G/T/A rs148651616 - CDS
3146..3146 A/G rs189362240 - CDS Nonsynonymous[Asn1045Ser]
3152..3152 C/T rs202244816 - CDS Nonsynonymous[Thr1047Ile]
3221..3221 G/A rs28913891 + CDS Nonsynonymous[Ser1070Asn]
3250..3250 C/A rs149947908 - CDS Nonsynonymous[Leu1080Ile]
3256..3256 T/A rs146190825 - CDS Nonsynonymous[Ser1082Thr]
3258..3258 C/T rs184267733 - CDS Synonymous[Ser1082Ser]
3260..3260 G/A rs142446654 - CDS Nonsynonymous[Ser1083Asn]
3268..3268 A/G rs28913892 + CDS Nonsynonymous[Thr1086Ala]
3345..3345 C/T rs201035509 - CDS Synonymous[Cys1111Cys]
3399..3399 A/G rs148342392 - CDS Synonymous[Glu1129Glu]
3425..3425 C/T rs143405311 - CDS Nonsynonymous[Ser1138Phe]
3451..3451 A/G rs138532009 - CDS Nonsynonymous[Thr1147Ala]
3457..3457 C/G rs199707055 - CDS Nonsynonymous[Pro1149Ala]
3471..3471 C/T rs141543536 - CDS Synonymous[Asn1153Asn]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;