H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000114879 Last modified: 27-May-2015
Definition: Epoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000114879
Length 455
Codon Adaptation Index (CAI). 0.841
Database links RefSeq NA
UniProt P07099 ;
CCDS P07099;
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000335223
H-Inv cluster ID Locus view HIX0199950
Predicted CDS 42..1409 ; 455[aa] ; Orientation:+3 ;
Genomic location Chromosome 1
Location 1q42.12
CDS position 225997836-226033261
Strand +
Accession number BC003567.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:111065 IMAGE:30377793
Experimental resources NBRC: NITE Biological Resource Center NBRC     Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (EPHX1) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (EPHX1) ;
Length of cDNA 1639[bp] (No. of exon:9)[A:368 T:361 G:414 C:496] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2052 ;
KEGG GENES KEGG GENES(2052) ;
GeneCard GeneCard EPHX1 ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000031605
H-Inv cluster IDLocus view HIX0199950
Accession numberBC003567.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionEpoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome1
Location1q42.12
CDS position226016426-226033261
Strand+
Gene structure8 exons
No.2
H-Inv IDTranscript view HIT000033702
H-Inv cluster IDLocus view HIX0199950
Accession numberBC008291.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionEpoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome1
Location1q42.12
CDS position226016426-226033261
Strand+
Gene structure8 exons
No.3
H-Inv IDTranscript view HIT000191165
H-Inv cluster IDLocus view HIX0199950
Accession numberJ03518.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionEpoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome1
Location1q42.12
CDS position226013089-226033260
Strand+
Gene structure9 exons
No.4
H-Inv IDTranscript view HIT000192649
H-Inv cluster IDLocus view HIX0199950
Accession numberL25879.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionEpoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome1
Location1q42.12
CDS position226013055-226033261
Strand+
Gene structure9 exons
No.5
H-Inv IDTranscript view HIT000321289
H-Inv cluster IDLocus view HIX0199950
Accession numberX07936.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionEpoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome1
Location1q42.12
CDS position226013177-226033264
Strand+
Gene structure9 exons
No.6
H-Inv IDTranscript view HIT000335223
H-Inv cluster IDLocus view HIX0199950
Accession numberBC095430.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionEpoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help Representative H-Inv IDRepresentative transcript; Splicing isoformSplicing isoform;
Genomic Location G-integra Help Chromosome1
Location1q42.12
CDS position225997836-226033261
Strand+
Gene structure9 exons
No.7
H-Inv IDTranscript view HIT000722612
H-Inv cluster IDLocus view HIX0199950
Accession numberKF032815.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionEpoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category HelpIdentical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Transcript feature Help Splicing isoformSplicing isoform;
Genomic Location G-integra Help Chromosome1
Location1q42.12
CDS position225998114-226033261
Strand+
Gene structure9 exons

Motif information in predicted CDS
ORF

length(456),orf(42:1409)
MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRP
FKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNE
FDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGW
PGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFN
SVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNM
ALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM
HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSA
FPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLS
VLERQ*
a.a.
length
InterPro Name
length(419), motif(33:451) 419IPR029058Alpha/Beta hydrolase fold [Domain]
length(408), motif(42:449) 408IPR029058Alpha/Beta hydrolase fold [Domain]
length(113), motif(49:161) 113IPR010497Epoxide hydrolase, N-terminal [Domain]
length(19), motif(148:166) 19IPR000639Epoxide hydrolase-like [Family]
length(16), motif(177:192) 16IPR000639Epoxide hydrolase-like [Family]
length(217), motif(178:394) 217IPR000073Alpha/beta hydrolase fold-1 [Domain]
length(14), motif(222:235) 14IPR000639Epoxide hydrolase-like [Family]
length(14), motif(236:249) 14IPR000639Epoxide hydrolase-like [Family]
length(17), motif(394:410) 17IPR000639Epoxide hydrolase-like [Family]
length(23), motif(426:448) 23IPR000639Epoxide hydrolase-like [Family]

Protein function information
H-Inv protein ID HIP000114879
Representative H-Inv transcript ID Transcript view HIT000335223
H-Inv cluster ID Locus view HIX0199950
Definition Epoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category Help Identical to known human protein(Category I).
Identical to known human protein (P07099) [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number EC 3.3.2.9 microsomal epoxide hydrolase
KEGG metabolic pathway 00980 Metabolism of xenobiotics by cytochrome P450
Protein-protein interaction (PPI) PPI viewer No. of interaction 1
Interaction partner(s) HIP000135231;
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
UniProt P07099 ;
CCDS P07099;
Gene symbol/name HGNC symbol EPHX1
HGNC aliases NA
HGNC name epoxide hydrolase 1, microsomal (xenobiotic);
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT endoplasmic;
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified : 27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
42 449 1qo7A 4e-32 26.0 369/385 c.69.1.11
Related H-InvDB links GTOP GTOP

Evolutionary information
Relationship Species Accession number MGI Links
Orthology Danio sp. (Zebrafish) BC045930 G-integraG-integra
Orthology Mus sp. (Mouse) BC061493 MGI:95405 G-integraG-integra
Orthology Rattus sp. (Rat) BC061568 G-integraG-integra
Orthology Bos sp. (Cow) BC102117 G-integraG-integra
Orthology Pongo sp. (Orangutan) CR860921 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000024109 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000020870 G-integraG-integra
Orthology Macaca sp. (Macaque) ENSMMUT00000000914 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000015053 G-integraG-integra
Orthology Pan sp. (Chimpanzee) ENSPTRT00000003733 G-integraG-integra
Orthology Rattus sp. (Rat) ENSRNOT00000029787 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00030811001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000148495 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001376568 G-integraG-integra
Orthology Gallus sp. (Chicken) XM_419386 G-integraG-integra
Orthology Gallus sp. (Chicken) XM_419497 G-integraG-integra
Orthology Canis sp. (Dog) XM_537235 G-integraG-integra
Phylogenetic tree [View by ATV] TNeighbor-joining (phb) 
Related H-InvDB links EvolaEvola dN/dS

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
71..71 G/A rs200493338 + CDS Synonymous[Val10Val]
77..77 C/T rs148398736 + CDS Synonymous[Gly12Gly]
118..118 C/G rs200146699 + CDS Nonsynonymous[Thr26Ser]
162..162 G/A rs11540967 + CDS Nonsynonymous[Ala41Thr]
169..169 G/C rs3738046 + CDS Nonsynonymous[Arg43Thr]
186..186 C/T rs2234697 + CDS Nonsynonymous[Arg49Cys]
206..206 G/A rs182154631 + CDS Synonymous[Thr55Thr]
216..216 G/T rs11540969 + CDS AA-STOP[Glu59*]
231..231 C/A rs146362595 + CDS Nonsynonymous[His64Asn]
245..245 T/C rs2234698 + CDS Synonymous[Asp68Asp]
252..252 C/T rs148240980 + CDS Nonsynonymous[Arg71Cys]
253..253 G/A rs58623835 + CDS Nonsynonymous[Arg71His]
272..272 G/A rs55798709 + CDS Synonymous[Glu77Glu]
287..287 C/G rs145942697 + CDS Nonsynonymous[His82Gln]
305..305 C/T rs139835798 + CDS Synonymous[Asn88Asn]
331..331 G/A rs4986931 + CDS AA-STOP[Trp97*]
344..344 T/C rs2234699 + CDS Synonymous[Phe101Phe]
360..360 G/C rs200804772 + CDS Nonsynonymous[Val107Leu]
376..376 G/A rs145813024 + CDS Nonsynonymous[Arg112Lys]
378..378 T/C rs1051740 + CDS Nonsynonymous[Tyr113His]
391..391 A/G rs67892231 + CDS Nonsynonymous[Lys117Arg]
398..398 G/A rs1131873 + CDS Synonymous[Lys119Lys]
398..398 G/A rs2292566 + CDS Synonymous[Lys119Lys]
424..424 T/C rs138091095 + CDS Nonsynonymous[Ile128Thr]
428..428 C/A/T rs112721617 + CDS
450..450 G/A rs141157588 + CDS Nonsynonymous[Ala137Thr]
456..456 C/T rs55784606 + CDS Nonsynonymous[His139Tyr]
457..457 A/G rs2234922 + CDS Nonsynonymous[His139Arg]
494..494 C/T rs147296174 + CDS Synonymous[Pro151Pro]
497..497 C/T rs144904318 + CDS Synonymous[Gly152Gly]
506..506 C/T rs199979074 + CDS Synonymous[Tyr155Tyr]
535..535 C/T rs139835141 + CDS Nonsynonymous[Thr165Ile]
564..564 G/A rs151050888 + CDS Nonsynonymous[Glu175Lys]
624..624 T/C rs140788022 + CDS Nonsynonymous[Ser195Pro]
678..678 C/T rs112886664 + CDS Synonymous[Leu213Leu]
727..727 C/T rs138769642 + CDS Nonsynonymous[Ser229Phe]
745..745 T/C rs148810909 + CDS Nonsynonymous[Met235Thr]
771^772 -/A rs66903687 + CDS
772..772 A/G rs141680636 + CDS Nonsynonymous[Lys244Arg]
782..782 C/T rs34143170 + CDS Synonymous[His247His]
783^784 -/TT rs56132313 + CDS
803..803 A/G rs35561387 + CDS Synonymous[Leu254Leu]
809..809 C/A rs56300109 + CDS Nonsynonymous[Asn256Lys]
813..813 T/G rs148730399 + CDS Nonsynonymous[Ser258Ala]
819..819 C/T rs35967527 + CDS Synonymous[Leu260Leu]
824..824 C/T rs146743027 + CDS Synonymous[Thr261Thr]
864..864 A/G rs35073925 + CDS Nonsynonymous[Thr275Ala]
893..893 C/T rs2292568 + CDS Synonymous[Pro284Pro]
894..894 G/C rs45449793 + CDS Nonsynonymous[Val285Leu]
911..911 C/T rs1803538 + CDS Synonymous[Phe290Phe]
969..969 G/A rs143164964 + CDS Nonsynonymous[Val310Ile]
1097..1097 C/T rs140207745 + CDS Synonymous[Asp352Asp]
1112..1112 C/T rs1051741 + CDS Synonymous[Asn357Asn]
1162..1162 A/C rs72549341 + CDS Nonsynonymous[Tyr374Ser]
1202..1202 T/A rs2137841 - CDS Nonsynonymous[His387Gln]
1205..1205 G/A rs150700932 + CDS Synonymous[Glu388Glu]
1257..1257 T/C rs2234700 + CDS Synonymous[Leu406Leu]
1264..1264 C/T rs45495897 + CDS Nonsynonymous[Thr408Met]
1280..1280 G/A rs45540739 + CDS Synonymous[Val413Val]
1283..1283 G/A rs142674326 + CDS Synonymous[Arg414Arg]
1289..1289 G/A rs4149229 + CDS Synonymous[Lys416Lys]
1323..1323 C/T rs199757500 + CDS Nonsynonymous[Arg428Cys]
1324..1324 G/A rs141221713 + CDS Nonsynonymous[Arg428His]
1340..1340 G/A rs45550332 + CDS Synonymous[Ala433Ala]
1355..1355 G/A rs45464298 + CDS Synonymous[Pro438Pro]
1382..1382 G/A rs202036186 + CDS Synonymous[Lys447Lys]
1391..1391 G/C rs4149230 + CDS Synonymous[Ser450Ser]
1396..1396 T/A rs45563137 + CDS Nonsynonymous[Leu452Gln]
1402..1402 G/A rs2234701 + CDS Nonsynonymous[Arg454Gln]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;