H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000194386 Last modified: 27-May-2015
Definition: Similar to Eukaryotic translation initiation factor 5B; eIF-5B; Translation initiation factor IF-2;
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000194386
Length 751
Codon Adaptation Index (CAI). 0.701
Database links RefSeq NA
UniProt NA
CCDS NA
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000427042
H-Inv cluster ID Locus view HIX0002308
Predicted CDS 1142..3394 ; 751[aa] ; Orientation:+2 ;
Genomic location Chromosome 2
Location 2q11.2
CDS position 99953852-100011320
Strand +
Accession number AK308176.1
CAGE tag ID NA
EST ID NA
Clone Number PLACE7007577
Experimental resources NBRC: NITE Biological Resource Center NBRC     Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (EIF5B) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (EIF5B) ;
Length of cDNA 3394[bp] (No. of exon:21)[A:1333 T:684 G:874 C:503] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9669 ;
KEGG GENES KEGG GENES(9669) ;
GeneCard GeneCard EIF5B ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000427042
H-Inv cluster IDLocus view HIX0002308
Accession numberAK308176.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSimilar to Eukaryotic translation initiation factor 5B; eIF-5B; Translation initiation factor IF-2;
Similarity category HelpSimilar to known protein(Category II).
Similar to known protein (O60841) [Identity/coverage = 99.628%/88.2%] to Homo sapiens (Human). protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome2
Location2q11.2
CDS position99953852-100011320
Strand+
Gene structure21 exons

Motif information in predicted CDS
ORF

length(751),orf(1142:3394)
EEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKREEEERIKRLEELEAK
RKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAEATLKL
LQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEV
MEQGVPEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHI
EVKENPEEEEEEEEEEEEDEESEEEEEEEGESEGSEGDEEDEKVSDEKDS
GKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKRRIEKRRLEHSKNVN
TEKLRAPIICVLGHVGTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPL
EAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAIL
VVDIMHGLEPQTIESINLLKSKKCPFIVALNKTDRLYDWKKSPDSDVAAT
LKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSA
HTGDGMGSLIYLLVELTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDV
ILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPMKELRVKNQYEKHKEV
EAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIK
LEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVML
EHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQD
Y
a.a.
length
InterPro Name
length(228), motif(293:520) 228IPR027417P-loop containing nucleoside triphosphate hydrolase [Domain]
length(299), motif(297:595) 299IPR027417P-loop containing nucleoside triphosphate hydrolase [Domain]
length(211), motif(307:517) 211IPR000795Elongation factor, GTP-binding domain [Domain]
length(14), motif(308:321) 14IPR000795Elongation factor, GTP-binding domain [Domain]
length(146), motif(309:454) 146IPR005225Small GTP-binding protein domain [Domain]
length(11), motif(374:384) 11IPR000795Elongation factor, GTP-binding domain [Domain]
length(12), motif(390:401) 12IPR000795Elongation factor, GTP-binding domain [Domain]
length(10), motif(426:435) 10IPR000795Elongation factor, GTP-binding domain [Domain]
length(75), motif(545:619) 75IPR004161Translation elongation factor EFTu/EF1A, domain 2 [Domain]
length(112), motif(639:750) 112IPR023115Translation initiation factor IF- 2, domain 3 [Domain]
length(106), motif(640:745) 106IPR023115Translation initiation factor IF- 2, domain 3 [Domain]
length(78), motif(655:732) 78IPR023115Translation initiation factor IF- 2, domain 3 [Domain]

Protein function information
H-Inv protein ID HIP000194386
Representative H-Inv transcript ID Transcript view HIT000427042
H-Inv cluster ID Locus view HIX0002308
Definition Similar to Eukaryotic translation initiation factor 5B; eIF-5B; Translation initiation factor IF-2;
Similarity category Help Similar to known protein(Category II).
Similar to known protein (O60841) [Identity/coverage = 99.628%/88.2%] to Homo sapiens (Human). protein.
Gene family/group H-Inv gene family/group ID HIF0001788
Gene family/group name Ribosomal protein L30, ferredoxin-like fold domain (IPR016082).
Evidence motif (InterPro) ID 3
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction 20
Interaction partner(s) HIP000021550; HIP000022756; HIP000023351; HIP000031067; HIP000034709; HIP000047547; HIP000051441; HIP000051510; HIP000061576; HIP000069738; HIP000087949; HIP000097730; HIP000098568; HIP000101126; HIP000107876; HIP000132401; HIP000148859; HIP000181513; HIP000321221; HIP000339211;
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
UniProt NA
CCDS NA
Gene symbol/name HGNC symbol EIF5B
HGNC aliases NA
HGNC name eukaryotic translation initiation factor 5B;
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT cytosol;
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
1171..1171 A/C rs71413834 + CDS Synonymous[Gly10Gly]
1175..1175 A/G rs10642 + CDS Nonsynonymous[Ser12Gly]
1177..1177 C/A rs75521402 + CDS Nonsynonymous[Ser12Arg]
1184..1184 A/T rs11547668 + CDS Nonsynonymous[Thr15Ser]
1231..1231 A/G rs17352888 + CDS Synonymous[Glu30Glu]
1244..1244 A/G rs3205296 - CDS Nonsynonymous[Arg35Gly]
1279..1279 A/G rs1801875 + CDS Synonymous[Glu46Glu]
1301..1301 G/A rs199730736 + CDS Nonsynonymous[Glu54Lys]
1333..1333 G/A rs3208852 - CDS Synonymous[Arg64Arg]
1352..1352 G/A rs1135362 - CDS Nonsynonymous[Glu71Lys]
1356..1356 G/A rs1135361 - CDS Nonsynonymous[Arg72Lys]
1381..1381 G/T rs117138860 + CDS Synonymous[Gly80Gly]
1383..1383 A/G rs199686500 + CDS Nonsynonymous[Lys81Arg]
1432..1432 T/C rs139598770 + CDS Synonymous[Thr97Thr]
1452..1452 A/C rs190999744 + CDS Nonsynonymous[Gln104Pro]
1516..1516 G/A rs3205291 - CDS Synonymous[Lys125Lys]
1528..1528 A/G rs199551427 + CDS Nonsynonymous[Ile129Met]
1565..1565 A/G rs147438767 + CDS Nonsynonymous[Met142Val]
1574..1574 T/C rs199806211 + CDS Nonsynonymous[Cys145Arg]
1656..1656 A/G rs202035862 + CDS Nonsynonymous[Asp172Gly]
1664..1664 G/A rs201564019 + CDS Nonsynonymous[Asp175Asn]
1731..1731 A/C/G/T rs7558074 + CDS
1800..1800 A/G rs201864125 + CDS Nonsynonymous[Glu220Gly]
1928..1928 A/G/T rs111801819 + CDS
1987..1987 C/G rs182287715 + CDS Nonsynonymous[Asp282Glu]
1998..1998 G/A rs149537328 + CDS Nonsynonymous[Arg286Gln]
2013..2013 G/A rs192772936 + CDS Nonsynonymous[Arg291Gln]
2016..2016 G/A rs200234310 + CDS Nonsynonymous[Arg292Gln]
2043..2043 C/A rs115723036 + CDS Nonsynonymous[Thr301Asn]
2044..2044 C/T rs11896520 + CDS Synonymous[Thr301Thr]
2092^2093 -/G rs34091582 + CDS
2140..2140 T/C rs1376443 - CDS Synonymous[Asp333Asp]
2141..2141 G/A rs189351546 + CDS Nonsynonymous[Gly334Ser]
2164..2164 A/G rs200683998 + CDS Synonymous[Gln341Gln]
2237..2237 G/A rs79534644 + CDS Nonsynonymous[Glu366Lys]
2247..2247 G/A rs202124160 + CDS Nonsynonymous[Arg369Gln]
2333..2333 G/T rs184913304 + CDS Nonsynonymous[Ala398Ser]
2398..2398 C/A rs201277682 + CDS Synonymous[Leu419Leu]
2446..2446 G/A rs187237106 + CDS Synonymous[Arg435Arg]
2466..2466 G/A rs200883389 + CDS Nonsynonymous[Ser442Asn]
2546..2546 A/G rs192420726 + CDS Nonsynonymous[Ile469Val]
2547..2547 T/C rs140396316 + CDS Nonsynonymous[Ile469Thr]
2575..2575 G/A rs187135905 + CDS Synonymous[Leu478Leu]
2783..2783 A/G rs191568464 + CDS Nonsynonymous[Ile548Val]
2785..2785 A/G rs138045797 + CDS Nonsynonymous[Ile548Met]
2836^2837 -/C rs35199153 + CDS
2931..2931 A/G rs200197574 + CDS Nonsynonymous[His597Arg]
2939..2939 G/T rs3205290 - CDS Nonsynonymous[Val600Leu]
3049..3049 T/C rs199674726 + CDS Synonymous[Asp636Asp]
3127..3127 A/G rs3197957 - CDS Synonymous[Thr662Thr]
3130..3130 G/A rs149654810 + CDS Synonymous[Leu663Leu]
3267..3267 T/A rs17853071 + CDS Nonsynonymous[Ile709Asn]
3375..3375 C/A rs76992586 + CDS Nonsynonymous[Thr745Lys]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;