H-InvDB x AHG DB
Protein view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
ホーム クイックガイド 検索ナビ BLAST サイトマップ データダウンロード 問い合わせ ヘルプ
H-Inv protein ID: HIP000259563 Last modified: 27-May-2015
Definition: Similar to C-type lectin domain family 4 member F isoform 2.
[Summery][Full]
[Protein Info][Member][Motif] 
provide location, ID and descriptions of functional motifs (InterPro)[Function] 
provide human-curated functional definition, similarity
category and related evidences;  Gene name; 
HUGO gene symbols; GO term; EC number; pathway information (KEGG)[PTM][Subcellular loc.] 
provide subcellular localization prediction by WolfPSORT, Target P, SOSUI, TMHMM and PTS1[Protein Structure][Evolutionary info.] 
provide orthologs relationships, phylogenic trees and sequence alignments[Polymorphism/repeat] 
provide polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information

Protein information
HIP ID HIP000259563
Length 557
Codon Adaptation Index (CAI). 0.73
Database links RefSeq NA
UniProt NA
CCDS NA
Original transcript information
Representative H-Inv transcript ID Transcript view HIT000503051
H-Inv cluster ID Locus view HIX0002141
Predicted CDS 32..1705 ; 557[aa] ; Orientation:+2 ;
Genomic location Chromosome 2
Location 2p13.3
CDS position 71036251-71047686
Strand -
Accession number BC144652.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:178200 IMAGE:9053183
Experimental resources NBRC: NITE Biological Resource Center NBRC     Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (CLEC4F) ;   Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (CLEC4F) ;
Length of cDNA 1780[bp] (No. of exon:7)[A:538 T:389 G:451 C:402] ;
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:165530 ;
KEGG GENES KEGG GENES(165530) ;
GeneCard GeneCard CLEC4F ;
etc H-GOLD Human-Gene diversity Of Life-style related Diseases ;
Protein view


Coresponding transcript member (s)
No.1
H-Inv IDTranscript view HIT000503051
H-Inv cluster IDLocus view HIX0002141
Accession numberBC144652.1
CAGE tag IDNA
EST IDNA
Coding potential Help Protein coding
DefinitionSimilar to C-type lectin domain family 4 member F isoform 2.
Similarity category HelpSimilar to known protein(Category II).
Similar to known protein (NP_001244956) [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Transcript feature Help NA
Genomic Location G-integra Help Chromosome2
Location2p13.3
CDS position71036251-71047686
Strand-
Gene structure7 exons

Motif information in predicted CDS
ORF

length(558),orf(32:1705)
MDGEAVRFCTDNQCVSLHPQEVDSVAMAPAAPKIPRLVQATPAFMAVTLV
FSLVTLFVVVQQQTRPVPKPVQAVILGDNITGHLPFEPNNHHHFGREAEM
RELIQTFKGHMENSSAWVVEIQMLKCRVDNVNSQLQVLGDHLGNTNADIQ
MVKGVLKDATTLSLQTQMLRSSLEGTNAEIQRLKEDLEKADALTFQTLNF
LKSSLENTSIELHVLSRGLENANSEIQMLNASLETANTQAQLANSSLKNA
NAEIYVLRGHLDSVNDLRTQNQVLRNSLEGANAEIQGLKENLQNTNALNS
QTQAFIKSSFDNTSAEIQFLRGHLERAGDEIHVLKRDLKMVTAQTQKANG
RLDQTDTQIQVFKSEMENVNTLNAQIQVLNGHMKNASREIQTLKQGMKNA
SALTSQTQMLDSNLQKASAEIQRLRGDLENTKALTMEIQQEQSRLKTLHV
VITSQEQLQRTQSQLLQMVLQGWKFNGGSLYYFSSVKKSWHEAEQFCVSQ
GAHLASVASKEEQAFLVEFTSKVYYWIGLTDRGTEGSWRWTDGTPFNAAQ
NKAATRG*
a.a.
length
InterPro Name
length(100), motif(450:549) 100IPR016186C-type lectin-like [Domain]
length(94), motif(456:549) 94IPR016187C-type lectin fold [Domain]
length(84), motif(469:552) 84IPR001304C-type lectin [Domain]
length(72), motif(476:547) 72IPR001304C-type lectin [Domain]
length(64), motif(487:550) 64IPR001304C-type lectin [Domain]

Protein function information
H-Inv protein ID HIP000259563
Representative H-Inv transcript ID Transcript view HIT000503051
H-Inv cluster ID Locus view HIX0002141
Definition Similar to C-type lectin domain family 4 member F isoform 2.
Similarity category Help Similar to known protein(Category II).
Similar to known protein (NP_001244956) [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Gene family/group H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
EC number NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer No. of interaction 20
Interaction partner(s) HIP000016685; HIP000027819; HIP000028809; HIP000039325; HIP000046193; HIP000057436; HIP000059239; HIP000063071; HIP000065568; HIP000065690; HIP000097985; HIP000108733; HIP000112838; HIP000114160; HIP000119302; HIP000168026; HIP000177012; HIP000361080; HIP000381996; HIP000381996;
BIND NA
DIP 111772E;
MINT MINT-2879054; MINT-2879073;
HPRD 03333;
IntAct NA
Database links RefSeq NA
UniProt NA
CCDS NA
Gene symbol/name HGNC symbol CLEC4F
HGNC aliases "C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13";
HGNC name C-type lectin domain family 4, member F;
Related H-InvDB links G-integraG-integra ; PPI viewer PPI view ; TACT TACT ;

Glycosylation
GPDB (GlycoProtDB)
GPDB
ID NA
Protein name NA
Organism NA
Length(aa) NA

Subcellular localization information
WoLF PSORT plasma membrane;
Target P Not predicted
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified : 27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
470 547 1ja3A 1e-23 25.6 78/115 d.169.1.1
Related H-InvDB links GTOP GTOP

Translation polymorphism (SNP) and microsatellite (STR) information

Single Nucleotide Polymorphism (SNP) and indel VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
38..38 G/A rs143957481 - CDS Nonsynonymous[Gly3Ser]
45..45 C/T rs202048172 - CDS Nonsynonymous[Ala5Val]
50..50 C/T rs111692180 - CDS Nonsynonymous[Arg7Cys]
85..85 C/A rs150690320 - CDS Nonsynonymous[His18Gln]
107..107 G/A rs200287098 - CDS Nonsynonymous[Ala26Thr]
114..114 C/G rs149541128 - CDS Nonsynonymous[Ala28Gly]
171..171 T/G rs76558637 - CDS Nonsynonymous[Val47Gly]
203..203 G/C rs147008752 - CDS Nonsynonymous[Val58Leu]
208..208 G/A rs200390148 - CDS Synonymous[Val59Val]
250..250 C/T rs17006361 - CDS Synonymous[Ala73Ala]
251..251 G/A rs140483573 - CDS Nonsynonymous[Val74Ile]
333..333 G/A rs2075221 - CDS Nonsynonymous[Arg101Gln]
387..387 T/C rs146659719 - CDS Nonsynonymous[Val119Ala]
404..404 A/C rs116477018 - CDS Nonsynonymous[Lys125Gln]
430..430 G/A rs183733688 - CDS Synonymous[Ser133Ser]
468..468 A/G rs61754946 - CDS Nonsynonymous[Asn146Ser]
481..481 G/C rs141757870 - CDS Nonsynonymous[Gln150His]
483..483 T/C rs117307369 - CDS Nonsynonymous[Met151Thr]
515..515 T/C rs200651188 - CDS Synonymous[Leu162Leu]
547^548 -/C rs34256142 - CDS
585..585 A/G rs111606232 - CDS Nonsynonymous[Glu185Gly]
604..604 T/C rs190522067 - CDS Synonymous[Asp191Asp]
619..619 G/T rs138316123 - CDS Nonsynonymous[Gln196His]
621..621 C/T rs149379407 - CDS Nonsynonymous[Thr197Met]
648..648 A/G rs201869143 - CDS Nonsynonymous[Glu206Gly]
671..671 G/A rs150218766 - CDS Nonsynonymous[Val214Met]
693..693 A/C rs200019956 - CDS Nonsynonymous[Asn221Thr]
714..714 T/G rs146602856 - CDS Nonsynonymous[Met228Arg]
735..735 C/T rs78458500 - CDS Nonsynonymous[Thr235Met]
760..760 C/T rs142040724 - CDS Synonymous[Ala243Ala]
763..763 T/C rs113852847 - CDS Synonymous[Asn244Asn]
773..773 A/G rs139690383 - CDS Nonsynonymous[Lys248Glu]
778..778 C/T rs142908853 - CDS Synonymous[Asn249Asn]
782..782 A/G rs62622841 - CDS Nonsynonymous[Asn251Asp]
816..816 A/T rs78241995 - CDS Nonsynonymous[Asp262Val]
920..920 G/A rs188433625 - CDS Nonsynonymous[Ala297Thr]
928..928 C/T rs144405556 - CDS Synonymous[Asn299Asn]
932..932 C/T rs199515969 - CDS AA-STOP[Gln301*]
937..937 C/G rs114209954 - CDS Synonymous[Thr302Thr]
1027..1027 C/T rs186061685 - CDS Synonymous[His332His]
1028..1028 G/A rs150268223 - CDS Nonsynonymous[Val333Met]
1077..1077 A/G rs35381972 + CDS Nonsynonymous[Asn349Ser]
1083..1083 G/A rs722896 + CDS Nonsynonymous[Arg351His]
1087..1087 G/T rs144360819 - CDS Synonymous[Leu352Leu]
1114..1114 A/G rs114477809 - CDS Synonymous[Val361Val]
1137..1137 T/C rs34318515 + CDS Nonsynonymous[Val369Ala]
1143..1143 C/T rs146366027 - CDS Nonsynonymous[Thr371Ile]
1144..1144 C/T rs180671756 - CDS Synonymous[Thr371Thr]
1169..1169 A/C rs115197636 - CDS Nonsynonymous[Asn380His]
1190..1190 A/G rs149210018 - CDS Nonsynonymous[Ser387Gly]
1212..1212 A/C rs137920767 - CDS Nonsynonymous[Lys394Thr]
1234..1234 A/G rs141231276 - CDS Synonymous[Ser401Ser]
1251..1251 C/T rs61740120 - CDS Nonsynonymous[Thr407Ile]
1254..1254 A/G rs150978300 - CDS Nonsynonymous[Gln408Arg]
1264..1264 C/T rs148473537 - CDS Synonymous[Asp411Asp]
1288..1288 C/T rs144178729 - CDS Synonymous[Ala419Ala]
1330..1330 T/C rs199714505 - CDS Synonymous[Ala433Ala]
1347..1347 A/C rs142016693 - CDS Nonsynonymous[Gln439Pro]
1456..1456 C/T rs201125258 - CDS Synonymous[Phe475Phe]
1485..1485 G/C rs150657543 - CDS Nonsynonymous[Ser485Thr]
1494..1494 A/G rs200559066 - CDS Nonsynonymous[Lys488Arg]
1511..1511 G/A rs142013309 - CDS Nonsynonymous[Glu494Lys]
1522..1522 C/T rs138154208 - CDS Synonymous[Cys497Cys]
1523..1523 G/A rs113999331 - CDS Nonsynonymous[Val498Met]
1566..1566 A/T rs145897327 - CDS Nonsynonymous[Glu512Val]
1578..1578 T/C rs34875126 + CDS Nonsynonymous[Leu516Pro]
1599..1599 T/C rs150339964 - CDS Nonsynonymous[Val523Ala]
1600..1600 G/C rs146771126 - CDS Synonymous[Val523Val]
1613..1613 G/A rs201804036 - CDS Nonsynonymous[Gly528Ser]
1624..1624 C/G rs144900238 - CDS Nonsynonymous[Asp531Glu]
1629..1629 G/A rs35001900 + CDS Nonsynonymous[Gly533Asp]
1646..1646 C/T rs148732839 - CDS Nonsynonymous[Arg539Cys]
1647..1647 G/A rs139353507 - CDS Nonsynonymous[Arg539His]
1664..1664 C/G rs143296096 - CDS Nonsynonymous[Pro545Ala]
1676..1676 G/A rs201579889 - CDS Nonsynonymous[Ala549Thr]
1681..1681 G/T rs145732605 - CDS Nonsynonymous[Gln550His]
1701..1701 G/T rs79617432 - CDS Nonsynonymous[Gly557Val]
Microsatellite (Short Tandem Repeat, STR)
LocationVariationStrand
No data available
Related H-InvDB links
VaryGeneVaryGene ;