H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000000053 Accession number: AB002345 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Period circadian protein homolog 2.
 
 

Transcript original information
Accession number AB002345.2
CAGE tag ID NA
EST ID NA
Clone Number hg015281
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PER2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PER2);
Sequence data provider Provider:KDRI
Annotation project H-Invitational FLcDNA
Length of cDNA 6219[bp] (No. of exon:23)[A:1537 T:1457 G:1557 C:1668]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type brain
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGTAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0200246
Genomic location  G-integra Help Chromosome 2
Location NA
Position 239152686- 239197092
Strand -
Possible duplicated location(s) NA
Gene structure 23 exon(s)
Database links RefSeq NM_022817
Ensembl ENST00000254657ENST00000254658ENST00000355768ENST00000431832ENST00000440245ENST00000491417
Entrez Gene Entrez Gene ID:8864
KEGG GENES KEGG GENES(8864)
GeneCard GeneCardPER2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000080042
Predicted CDS 123..3890;  1255[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.801
Database links RefSeq NP_073728
UniProt O15055
CCDS CCDS2528

Motif information
ORF

length(1255),orf(123:3890)
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTG
RDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
QSSKVDTHKELIKTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKA
NEEYYQLLMSSEGHPCGADVPSYTVEEMESVTSEHIVKNADMFAVAVSLV
SGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPL
WSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERA
VPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRF
RARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCT
EEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGSHEHLMSQTSS
SDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPA
EKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEA
ATLKRKCEFPANVPALRSSDKRKATVSPGPHAGEAEPPSRVNSRTGVGTH
LTSLALPGKAESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPES
LDCLAGPALACGLSQEKEPFKKLGLTKEVLAAHTQKEEQSFLQKFKEIRK
LSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSK
RVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSSCPAVPFPAPV
PAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPL
APVMAFMLPSYSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFP
SRTSIPRQPCACPATRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAP
...
a.a.
length
InterPro Name
length(68), motif(181:248) 68 IPR000014 PAS [Domain]
length(67), motif(321:387) 67 IPR000014 PAS [Domain]
length(85), motif(346:430) 85 IPR013655 PAS fold-3 [Domain]
length(44), motif(346:389) 44 IPR000014 PAS [Domain]
length(189), motif(1046:1234) 189 IPR022728 Period circadian-like, C-terminal [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000000053
H-Inv cluster ID Locus viewHIX0200246
Accession number AB002345.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Period circadian protein homolog 2.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_073728)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID HIF0000999
Gene family/group name Putative PAS fold-3 (IPR013655).
Evidence motif (InterPro) ID IPR013655
Gene symbol/name HGNC symbol PER2
HGNC aliases "period (Drosophila) homolog 2"
HGNC name period homolog 2 (Drosophila)
DDBJ KIAA0347
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000080042
No. of interaction 8
Interaction partner(s) HIP000041141HIP000048107HIP000048111HIP000049100HIP000061715HIP000086094HIP000098341HIP000118039
BIND 258412; 
DIP 117471E; 
MINT NA
HPRD 02919;  02920;  03774;  04122;  04864;  07226;  09050;  09138; 
IntAct EBI-1187581;  EBI-1084363; 
Database links RefSeq NM_022817
Ensembl ENST00000254657ENST00000254658ENST00000355768ENST00000431832ENST00000440245ENST00000491417
Entrez Gene Entrez Gene ID:8864
KEGG GENES KEGG GENES(8864)
GeneCard GeneCardPER2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Putative PAS fold-3 (IPR013655). Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function signal transducer activity (GO:0004871); 
Biological process signal transduction (GO:0007165); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
337 519 2btvA 2e-47 15.9 164/845 e.28.1.1
1102 1198 1mm8A 5e-04 17.5 97/100 c.55.3.4
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus 205251_at; 
HG-U133 205251_at;  208518_s_at; 
HG-U133A 205251_at;  208518_s_at; 
HG-U133A_2 205251_at;  208518_s_at; 
HG-U133B NA
HG-U133_Plus_2 205251_at;  208518_s_at; 
HG-U95 35008_at; 
HG-U95A 35008_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2534794;  2534796;  2534798;  2605750;  2605752;  2605753;  2605754;  2605755;  2605756;  2605757;  2605758;  2605759;  2605760;  2605762;  2605764;  2605765;  2605768;  2605771;  2605772;  2605774;  2605776;  2605778;  2605780;  2605781;  2605784;  2605785;  2605788;  2605789;  2605790;  2605796; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P209320; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P209320;  A_23_P411162; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name: Advanced sleep phase syndrome, familial (604348); 
Related information in OMIM OMIM ID:  603426;  Title: PERIOD, DROSOPHILA, HOMOLOG OF, 2
Co-localized orphan diseases OMIM ID:  600666607329609402
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(8864)
Disease Entrez Gene ID:(8864)
Substance Entrez Gene ID:(8864)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:26-Mar-2013
Relationship Species Accession number MGI Links
Orthology Rattus sp. (Rat) AB016532 G-integraG-integra
Orthology Gallus sp. (Chicken) AF246956 G-integraG-integra
Orthology Mus sp. (Mouse) AK165556 MGI:3560558 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000098004 G-integraG-integra
Orthology Monodelphis sp. (Opossum) ENSMODT00000013601 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000019353 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000020794 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000015498 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00013830001 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00026769001 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00028368001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000147284 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001086845 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_001154675 G-integraG-integra
Orthology Equus sp. (Horse) XM_001496867 G-integraG-integra
Orthology Canis sp. (Dog) XM_543306 G-integraG-integra
Orthology Bos sp. (Cow) XM_589710 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
96 .. 96 T/G rs115232299 - 5'UTR
111 .. 111 C/G rs2304672 + 5'UTR
135 .. 135 G/T rs35572922 - CDS Nonsynonymous[Ala5Ser]
431 .. 431 G/T rs114545224 - CDS Synonymous[Ser103Ser]
489 .. 489 C/G rs3739068 - CDS Nonsynonymous[Pro123Ala]
490 ^ 491 -/C rs35329790 - CDS
505 .. 505 C/A rs77311618 + CDS Nonsynonymous[Ala128Asp]
524 .. 524 G/A rs34749458 - CDS Synonymous[Thr134Thr]
564 .. 564 G/A rs2340885 + CDS Nonsynonymous[Val148Met]
644 .. 644 C/T rs115349318 - CDS Synonymous[Thr174Thr]
783 .. 783 G/A rs79524310 - CDS Nonsynonymous[Ala221Thr]
800 .. 800 G/A rs116439936 - CDS Synonymous[Lys226Lys]
1049 .. 1049 C/T rs35564455 - CDS Synonymous[Cys309Cys]
1067 .. 1067 G/A rs113438735 - CDS Synonymous[Glu315Glu]
1301 .. 1301 C/T rs115692307 - CDS Synonymous[Phe393Phe]
1323 .. 1323 C/T rs77146655 + CDS Nonsynonymous[Arg401Cys]
1391 ^ 1392 -/A rs34895723 - CDS
1409 .. 1409 T/C rs75221346 + CDS Synonymous[Ile429Ile]
1548 .. 1548 C/A rs80156481 + CDS Nonsynonymous[His476Asn]
1958 .. 1958 C/T rs116369782 - CDS Synonymous[Asn612Asn]
2087 .. 2087 A/G rs2304669 + CDS Synonymous[Ala655Ala]
2106 .. 2106 A/G rs121908635 + CDS Nonsynonymous[Ser662Gly]
2113 .. 2113 C/T rs70965448 + CDS Nonsynonymous[Ala664Val]
2114 .. 2114 G/A rs2304670 + CDS Synonymous[Ala664Ala]
2117 .. 2117 G/A rs2304671 + CDS Synonymous[Ser665Ser]
2307 .. 2307 G/A rs4429421 - CDS Nonsynonymous[Val729Ile]
2440 .. 2440 G/A rs79066297 + CDS Nonsynonymous[Arg773Gln]
2468 .. 2468 C/T rs10195959 - CDS Synonymous[Ser782Ser]
2582 .. 2582 G/A rs75156302 + CDS Synonymous[Arg820Arg]
2588 .. 2588 G/A rs34409863 - CDS Synonymous[Pro822Pro]
2604 .. 2604 G/A rs55704277 - CDS Nonsynonymous[Ala828Thr]
2694 .. 2694 G/A rs79645972 + CDS Nonsynonymous[Val858Met]
2704 .. 2704 C/T rs75724304 + CDS Nonsynonymous[Ala861Val]
2705 .. 2705 G/A rs78915190 + CDS Synonymous[Ala861Ala]
2715 .. 2715 G/A rs78793960 + CDS Nonsynonymous[Val865Met]
2737 .. 2737 C/T rs78545306 + CDS Nonsynonymous[Pro872Leu]
2748 .. 2748 T/C rs78832829 + CDS Nonsynonymous[Phe876Leu]
2829 .. 2829 G/A rs35333999 - CDS Nonsynonymous[Val903Ile]
2968 .. 2968 T/A rs35998480 - CDS Nonsynonymous[Phe949Tyr]
2976 .. 2976 C/T rs80292232 + CDS Nonsynonymous[Arg952Trp]
3023 .. 3023 C/T rs3739063 - CDS Synonymous[Ala967Ala]
3032 .. 3032 A/T rs75272725 + CDS Synonymous[Pro970Pro]
3204 .. 3204 C/T rs116038195 - CDS Nonsynonymous[Arg1028Trp]
3229 .. 3229 T/C rs76234418 + CDS Nonsynonymous[Leu1036Pro]
3411 .. 3411 A/G rs111652500 - CDS Nonsynonymous[Ser1097Gly]
3542 .. 3542 G/T rs79440143 + CDS Nonsynonymous[Met1140Ile]
3662 .. 3662 G/A rs117025694 - CDS Synonymous[Thr1180Thr]
3709 .. 3709 C/T rs75060790 + CDS Nonsynonymous[Thr1196Met]
3722 .. 3722 C/T rs35873326 - CDS Synonymous[Pro1200Pro]
3735 .. 3735 G/A rs76355956 - CDS Nonsynonymous[Val1205Met]
3801 .. 3801 A/G rs78614149 + CDS Nonsynonymous[Ile1227Val]
3829 .. 3829 C/T rs73088906 - CDS Nonsynonymous[Ser1236Leu]
3853 .. 3853 G/A rs934945 + CDS Nonsynonymous[Gly1244Glu]
3962 .. 3962 A/T rs10181662 - 3'UTR
4192 .. 4192 A/T rs10181401 - 3'UTR
4370 ^ 4371 -/T rs34195482 - 3'UTR
4457 .. 4457 C/T rs28391755 - 3'UTR
4539 .. 4539 C/T rs115565634 - 3'UTR
4805 .. 4805 A/T rs62194934 - 3'UTR
4819 .. 4819 G/T rs62194933 - 3'UTR
4958 .. 4958 C/T rs56386336 - 3'UTR
5141 .. 5141 A/T rs35093813 - 3'UTR
5168 .. 5168 T/C rs118094777 - 3'UTR
5193 ^ 5194 -/T rs72207807 - 3'UTR
5194 ^ 5195 -/TTT rs71043120 - 3'UTR
5195 .. 5195 T/C rs34391080 - 3'UTR
5360 ^ 5361 -/C rs34621267 - 3'UTR
5619 .. 5619 C/T rs7563135 - 3'UTR
5784 .. 5784 C/A rs79038429 - 3'UTR
5825 .. 5825 C/T rs114881551 - 3'UTR
6035 .. 6035 G/A rs80261926 - 3'UTR
6081 .. 6081 G/T rs76734143 - 3'UTR
6189 .. 6189 G/A rs77799108 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
AluSq 5191 5496 -
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer