H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000011223 Accession number: AK054609 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Kelch-like protein 1.
 
 

Motif information
ORF

length(588),orf(7:1773)
MSGSGRKDFDVKHILRLRWKLFSHPSPSTGGPAGGGCLQQDGSGSFEHWG
PSQSRLLKSQERSGVSTFWKKPSSSSSSSSSPSSSSSSFNPLNGTLLPVA
TRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHEKGLVLQELKV
EPDNSSQATGEGCGHRLSSTGHSMTPQSDLDSSSSEEFYQAVHHAEQTFR
KMESYLKQQQLCDVILIVGNRKIPAHRLVLSSVSDYFAAMFTSDVCEAKQ
EEIKMEGIDPNALWDLVQFAYTGCLELKEDTIENLLAAACLLQLPQVVEV
CCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEF
LLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAF
IRLPLLPPQILADLENHALFKNDLECQKLILEAMKYHLLPERRTLMQSPR
TKPRKSTVGTLYAVGGMDNNKGATTIEKYDLRTNLWIQAGMMNGRRLQFG
VAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMSTHRHGLEMGF
PHVDQAGLELLTSGDPPASASQSAGITSVSHLAWPLVQ*
a.a.
length
InterPro Name
length(118), motif(190:307) 118 IPR011333 BTB/POZ fold [Domain]
length(115), motif(193:307) 115 IPR011333 BTB/POZ fold [Domain]
length(104), motif(203:306) 104 IPR013069 BTB/POZ [Domain]
length(98), motif(212:309) 98 IPR000210 BTB/POZ-like [Domain]
length(68), motif(212:279) 68 IPR000210 BTB/POZ-like [Domain]
length(100), motif(314:413) 100 IPR011705 BTB/Kelch-associated [Domain]
length(102), motif(314:415) 102 IPR011705 BTB/Kelch-associated [Domain]
length(87), motif(459:545) 87 IPR015916 Galactose oxidase, beta-propeller [Domain]
length(34), motif(459:492) 34 IPR006652 Kelch repeat type 1 [Repeat]
length(47), motif(460:506) 47 IPR006652 Kelch repeat type 1 [Repeat]
length(45), motif(496:540) 45 IPR006652 Kelch repeat type 1 [Repeat]
length(47), motif(507:553) 47 IPR006652 Kelch repeat type 1 [Repeat]