H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000015962 Accession number: AK091095 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to 26S proteasome non-ATPase regulatory subunit 14; EC=3.4.19.-; 26S proteasome regulatory subunit RPN11; 26S proteasome-associated PAD1 homolog 1;
 
 

Transcript original information
Accession number AK091095.1
CAGE tag ID NA
EST ID NA
Clone Number BRSSN2000518
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PSMD14) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PSMD14);
Sequence data provider Project:FLJ; Provider:FLJ/HRI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 1786[bp] (No. of exon:2)[A:547 T:618 G:341 C:280]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type substantia nigra
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0002542
Genomic location  G-integra Help Chromosome 2
Location 2q24.2
Position 162264039- 162268226
Strand +
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard GeneCardPSMD14*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000130141
Predicted CDS 1283..1471;  62[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.691

Motif information
ORF

length(62),orf(1283:1471)
TLSFVFHSQAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQ
CLAAMLDTVVFK*
a.a.
length
InterPro Name
length(41), motif(7:47) 41 IPR024969 Rpn11/EIF3F C-terminal domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000015962
H-Inv cluster ID Locus viewHIX0002542
Accession number AK091095.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to 26S proteasome non-ATPase regulatory subunit 14; EC=3.4.19.-; 26S proteasome regulatory subunit RPN11; 26S proteasome-associated PAD1 homolog 1;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (O00487)  [Identity/coverage = 94.643%/18.06%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 9374539147020391548933417323924176936831921419319349277196903322126946022909820ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PSMD14
HGNC aliases NA
HGNC name proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
DDBJ NA
UniProt PSMD14
EC number EC 3.4.19.-Omega peptidases; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000130141
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard GeneCardPSMD14*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA231613; 
Affymetrix
GeneChip
HG-Focus 212296_at; 
HG-U133 212296_at; 
HG-U133A 212296_at; 
HG-U133A_2 212296_at; 
HG-U133B NA
HG-U133_Plus_2 212296_at; 
HG-U95 33247_at;  43809_at; 
HG-U95A 33247_at; 
HG-U95B 43809_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2512741;  2512742;  2512743;  2512744;  2512746;  2512747; 
HuGeneFL U86782_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P165691; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P165691; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
82 .. 82 C/T rs115217891 + 5'UTR
102 .. 102 T/C rs146576039 + 5'UTR
155 .. 155 C/T rs181528326 + 5'UTR
177 .. 177 A/G rs2018759 + 5'UTR
239 .. 239 C/T rs1110587 + 5'UTR
422 .. 422 G/A rs186177953 + 5'UTR
443 .. 443 G/A rs141371104 + 5'UTR
468 .. 468 G/C rs41264223 + 5'UTR
540 .. 540 A/G rs145114774 + 5'UTR
776 .. 776 A/G rs192150797 + 5'UTR
815 .. 815 C/T rs183925105 + 5'UTR
1083 .. 1083 C/A rs185901555 + 5'UTR
1151 .. 1151 G/T rs12471336 + 5'UTR
1232 .. 1232 A/G rs16845844 + 5'UTR
1256 .. 1256 G/C rs138920239 + 5'UTR
1426 .. 1426 T/C rs201522506 + CDS Synonymous[Ile48Ile]
1631 .. 1631 T/G rs78317453 + 3'UTR
1668 .. 1668 G/A rs1064576 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer