H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000015962 Accession number: AK091095 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to 26S proteasome non-ATPase regulatory subunit 14; EC=3.4.19.-; 26S proteasome regulatory subunit RPN11; 26S proteasome-associated PAD1 homolog 1;
 
 

Motif information
ORF

length(62),orf(1283:1471)
TLSFVFHSQAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQ
CLAAMLDTVVFK*
a.a.
length
InterPro Name
length(41), motif(7:47) 41 IPR024969 Rpn11/EIF3F C-terminal domain [Domain]