H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000020038_03 Accession number: AK095183 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Putative WAS protein family homolog 4; Protein FAM39CP;
 
 

Transcript original information
Accession number AK095183.1
CAGE tag ID NA
EST ID NA
Clone Number BRSSN2015982
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (WASH1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (WASH1);
Sequence data provider Project:FLJ; Provider:FLJ/HRI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 1997[bp] (No. of exon:9)[A:442 T:323 G:618 C:614]
Devision NA
Molecular type NA
Library origin Cell type NA
Tissue type substantia nigra
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGCAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0094926
Genomic location  G-integra Help Chromosome 12
Location 12p13.33
Position 78776- 91265
Strand +
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:374666
KEGG GENES KEGG GENES(374666)
GeneCard GeneCardWASH1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000072173
Predicted CDS 867..1661;  264[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.81

Motif information
ORF

length(264),orf(867:1661)
MLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQVPEIDVPSYLP
DLPGIANDLMYIADLGPGIAPSAPGTIPELPTFHTEVAEPLKADLQDGVL
TPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSTSPSVQGA
PREVVDPSGGWATLLESIRQAGGIGKAKLRSMKERKLEKKKQKEQEQVRA
TSQGGHLMSDLFNKLVMRRKGISGKGPGAGEGPGGAFARVSDSIPPVPPP
QQPQAEEDEDDWES*
a.a.
length
InterPro Name
length(263), motif(1:263) 263 IPR028290 WASH1 [Family]
length(102), motif(2:103) 102 IPR021854 WASH1, WAHD domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000020038_03
H-Inv cluster ID Locus viewHIX0094926
Accession number AK095183.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Putative WAS protein family homolog 4; Protein FAM39CP;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (A8MWX3)  [Identity/coverage = 90.33%/95.39%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 106555491561655318159949ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol WASH1
HGNC aliases "family with sequence similarity 39, member E"
HGNC name WAS protein family homolog 1
DDBJ NA
UniProt WASH4P
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000072173
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:374666
KEGG GENES KEGG GENES(374666)
GeneCard GeneCardWASH1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function alpha-tubulin binding (GO:0043014); 
Cellular component early endosome (GO:0005769); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  extracellular; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
367 .. 367 C/T rs147058759 + 5'UTR
1584 .. 1584 G/A rs71227149 + CDS Nonsynonymous[Val240Met]
1646 .. 1646 C/T/G/A rs17353727 - CDS
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer