H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000025525 Accession number: AL136929 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Mitochondrial Rho GTPase 1 isoform 2.
 
 

Transcript original information
Accession number AL136929.1
CAGE tag ID NA
EST ID NA
Clone Number DKFZp586D0222
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:DKFZ/MIPS
Annotation project H-Invitational FLcDNA
Length of cDNA 3247[bp] (No. of exon:18)[A:1015 T:1041 G:617 C:574]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type uterus
Develpmental stage adult
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 3231(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) TAGAAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0224164
Genomic location  G-integra Help Chromosome 17
Location 17q11.2
Position 30469649- 30536757
Strand +
Possible duplicated location(s) NA
Gene structure 18 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:55288
KEGG GENES KEGG GENES(55288)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000067741
Predicted CDS 64..1806;  580[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.707

Motif information
ORF

length(580),orf(64:1806)
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
VPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPL
INERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAK
NLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDN
DGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDGVADSGLTLKG
FLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVC
TNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVT
VTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIR
EDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICDVVCLVYDVSN
PKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHK
MPPPQAFTCNTADAPSKDIFVKLTTMAMYP*
a.a.
length
InterPro Name
length(177), motif(1:177) 177 IPR020860 MIRO [Domain]
length(201), motif(2:202) 201 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(169), motif(2:170) 169 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(160), motif(3:162) 160 IPR005225 Small GTP-binding protein domain [Domain]
length(22), motif(5:26) 22 IPR001806 Small GTPase superfamily [Family]
length(161), motif(6:166) 161 IPR001806 Small GTPase superfamily [Family]
length(14), motif(109:122) 14 IPR001806 Small GTPase superfamily [Family]
length(23), motif(144:166) 23 IPR001806 Small GTPase superfamily [Family]
length(90), motif(177:266) 90 IPR011992 EF-hand domain pair [Domain]
length(36), motif(184:219) 36 IPR002048 EF-hand domain [Domain]
length(29), motif(188:216) 29 IPR002048 EF-hand domain [Domain]
length(13), motif(197:209) 13 IPR018247 EF-Hand 1, calcium-binding site [Binding_site]
length(89), motif(218:306) 89 IPR013567 EF hand associated, type-2 [Domain]
length(36), motif(304:339) 36 IPR002048 EF-hand domain [Domain]
length(57), motif(308:364) 57 IPR011992 EF-hand domain pair [Domain]
length(29), motif(308:336) 29 IPR002048 EF-hand domain [Domain]
length(26), motif(309:334) 26 IPR002048 EF-hand domain [Domain]
length(75), motif(340:414) 75 IPR013566 EF hand associated, type-1 [Domain]
length(169), motif(412:580) 169 IPR020860 MIRO [Domain]
length(164), motif(414:577) 164 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(165), motif(415:579) 165 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(111), motif(420:530) 111 IPR013684 Mitochondrial Rho-like [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000025525
H-Inv cluster ID Locus viewHIX0224164
Accession number AL136929.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Similar to Mitochondrial Rho GTPase 1 isoform 2.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_001028738)  [Identity/coverage = 100.0%/88.01%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ DKFZp586D0222
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000067741
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:55288
KEGG GENES KEGG GENES(55288)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR191362
Accession
Description
Location
PMID

Gene ontology information
Molecular function GTP binding (GO:0005525);  calcium ion binding (GO:0005509); 
Biological process small GTPase mediated signal transduction (GO:0007264); 
Cellular component intracellular (GO:0005622); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  extracellular; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
16 171 1e6vB1 9e-19 16.0 144/253 a.89.1.1
177 334 1xo5A 1e-13 17.5 154/174 a.39.1.5
309 367 1wlzA1 1e-05 20.3 59/83 a.39.1.7
419 552 1a2kC 9e-07 11.9 126/196 c.37.1.8
544 580 1ndbA2 3e-04 30.4 23/220 c.43.1.3
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB240808; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 224044_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 224044_at; 
HG-U133_Plus_2 224044_at; 
HG-U95 50998_at; 
HG-U95A NA
HG-U95B 50998_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3503427;  3503428;  3503429;  3503430;  3503431;  3717541;  3717542;  3717545;  3717548;  3717549;  3717550;  3717551;  3717555;  3717556;  3717558;  3717559;  3717560;  3717561;  3717562;  3717563;  3717564;  3717566;  3717567;  3717568;  3717570;  3717572;  3717576;  3717577;  3717578;  3717579;  3752582;  3752587;  3780495;  3780496;  3925286;  3925287;  3925288; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P433204; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P433204;  A_24_P59765; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
214 .. 214 G/A rs145143892 + CDS Nonsynonymous[Val51Ile]
255 .. 255 T/A rs199735465 + CDS Nonsynonymous[Ser64Arg]
429 .. 429 G/T rs201893717 + CDS Synonymous[Leu122Leu]
476 .. 476 A/G rs116363165 + CDS Nonsynonymous[Tyr138Cys]
537 .. 537 C/T rs147576979 + CDS Synonymous[Leu158Leu]
546 .. 546 C/T rs201021051 + CDS Synonymous[Tyr161Tyr]
693 .. 693 C/T rs141985401 + CDS Synonymous[Asn210Asn]
753 .. 753 G/A rs145734789 + CDS Synonymous[Lys230Lys]
829 .. 829 A/T rs28630420 + CDS Nonsynonymous[Thr256Ser]
881 .. 881 G/A rs116192944 + CDS Nonsynonymous[Arg273Gln]
900 .. 900 C/T rs149000823 + CDS Synonymous[Asp279Asp]
927 .. 927 C/- rs111248500 + CDS
1014 .. 1014 T/C rs115949021 + CDS Synonymous[Asp317Asp]
1109 ^ 1110 -/T rs34538349 + CDS
1188 .. 1188 G/A rs114899192 + CDS Synonymous[Gln375Gln]
1245 .. 1245 T/G rs57831260 + CDS Synonymous[Ser394Ser]
1247 .. 1247 A/G rs141923086 + CDS Nonsynonymous[Gln395Arg]
1266 .. 1266 G/T rs201011889 + CDS Synonymous[Val401Val]
1298 .. 1298 A/C rs199972893 + CDS Nonsynonymous[Lys412Thr]
1521 .. 1521 A/G rs16967164 + CDS Synonymous[Glu486Glu]
1535 .. 1535 T/C rs138851743 + CDS Nonsynonymous[Val491Ala]
1554 .. 1554 T/C rs191457576 + CDS Synonymous[Asp497Asp]
1574 .. 1574 T/C rs80181477 + CDS Nonsynonymous[Phe504Ser]
1608 .. 1608 T/A rs141986224 + CDS Nonsynonymous[Phe515Leu]
1655 .. 1655 T/G rs146295337 + CDS Nonsynonymous[Leu531Arg]
1678 .. 1678 A/G rs139664057 + CDS Nonsynonymous[Ser539Gly]
1742 .. 1742 A/G rs149321179 + CDS Nonsynonymous[Asn560Ser]
1754 .. 1754 C/G rs199545262 + CDS Nonsynonymous[Ala564Gly]
1813 .. 1813 G/C rs200669163 + 3'UTR
1880 .. 1880 C/T rs58319842 + 3'UTR
1934 .. 1934 A/G rs112408498 + 3'UTR
1942 .. 1942 G/C rs141411158 + 3'UTR
2039 .. 2039 A/G rs150837641 + 3'UTR
2045 .. 2045 T/C rs192685155 + 3'UTR
2158 .. 2158 A/C rs139256333 + 3'UTR
2269 .. 2269 G/A rs1039401 - 3'UTR
2329 .. 2329 C/T rs9889830 + 3'UTR
2330 .. 2330 G/A rs17780304 + 3'UTR
2392 .. 2392 T/C rs112294661 + 3'UTR
2419 .. 2419 G/A rs184725151 + 3'UTR
2698 .. 2698 T/C rs113888799 + 3'UTR
2831 .. 2831 T/A rs11537590 + 3'UTR
2865 .. 2865 C/T rs144578639 + 3'UTR
2908 .. 2908 G/T rs148455732 + 3'UTR
2912 .. 2912 A/G rs201844588 + 3'UTR
3063 .. 3063 G/A rs35910231 + 3'UTR
3112 .. 3112 A/G rs142826460 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer