H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000025525 Accession number: AL136929 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Mitochondrial Rho GTPase 1 isoform 2.
 
 

Motif information
ORF

length(580),orf(64:1806)
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
VPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPL
INERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAK
NLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDN
DGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDGVADSGLTLKG
FLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVC
TNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVT
VTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIR
EDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICDVVCLVYDVSN
PKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHK
MPPPQAFTCNTADAPSKDIFVKLTTMAMYP*
a.a.
length
InterPro Name
length(177), motif(1:177) 177 IPR020860 MIRO [Domain]
length(201), motif(2:202) 201 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(169), motif(2:170) 169 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(160), motif(3:162) 160 IPR005225 Small GTP-binding protein domain [Domain]
length(22), motif(5:26) 22 IPR001806 Small GTPase superfamily [Family]
length(161), motif(6:166) 161 IPR001806 Small GTPase superfamily [Family]
length(14), motif(109:122) 14 IPR001806 Small GTPase superfamily [Family]
length(23), motif(144:166) 23 IPR001806 Small GTPase superfamily [Family]
length(90), motif(177:266) 90 IPR011992 EF-hand domain pair [Domain]
length(36), motif(184:219) 36 IPR002048 EF-hand domain [Domain]
length(29), motif(188:216) 29 IPR002048 EF-hand domain [Domain]
length(13), motif(197:209) 13 IPR018247 EF-Hand 1, calcium-binding site [Binding_site]
length(89), motif(218:306) 89 IPR013567 EF hand associated, type-2 [Domain]
length(36), motif(304:339) 36 IPR002048 EF-hand domain [Domain]
length(57), motif(308:364) 57 IPR011992 EF-hand domain pair [Domain]
length(29), motif(308:336) 29 IPR002048 EF-hand domain [Domain]
length(26), motif(309:334) 26 IPR002048 EF-hand domain [Domain]
length(75), motif(340:414) 75 IPR013566 EF hand associated, type-1 [Domain]
length(169), motif(412:580) 169 IPR020860 MIRO [Domain]
length(164), motif(414:577) 164 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(165), motif(415:579) 165 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(111), motif(420:530) 111 IPR013684 Mitochondrial Rho-like [Domain]