H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000025799 Accession number: AL137511 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Chaperone activity of bc1 complex-like, mitochondrial; Chaperone-ABC1-like; EC=2.7.11.-; aarF domain-containing protein kinase 3; Precursor;
 
 

Transcript original information
Accession number AL137511.1
CAGE tag ID NA
EST ID NA
Clone Number DKFZp761M222
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ADCK3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ADCK3);
Sequence data provider Provider:DKFZ/MIPS
Annotation project H-Invitational FLcDNA
Length of cDNA 1608[bp] (No. of exon:7)[A:351 T:357 G:453 C:447]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type amygdala
Develpmental stage adult
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Reverse orientation revised;  Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001648
Genomic location  G-integra Help Chromosome 1
Location 1q42.13
Position 227171250- 227175161
Strand +
Possible duplicated location(s) NA
Gene structure 7 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:56997
KEGG GENES KEGG GENES(56997)
GeneCard GeneCardADCK3*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000008407
Predicted CDS 1..885;  294[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.885

Motif information
ORF

length(294),orf(1:885)
EVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELA
LECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPL
DQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQHKV
ALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVK
VMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPP
EETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ*
a.a.
length
InterPro Name
length(80), motif(1:80) 80 IPR004147 UbiB domain [Domain]
length(164), motif(3:166) 164 IPR011009 Protein kinase-like domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000025799
H-Inv cluster ID Locus viewHIX0001648
Accession number AL137511.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Chaperone activity of bc1 complex-like, mitochondrial; Chaperone-ABC1-like; EC=2.7.11.-; aarF domain-containing protein kinase 3; Precursor;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q8NI60)  [Identity/coverage = 100.0%/45.44%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 11888884147020391548933415498874167104141734484617974005183190721831907421269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ADCK3
HGNC aliases "chaperone-ABC1 (activity of bc1 complex, S.pombe)-like", "chaperone, ABC1 activity of bc1 complex like (S. pombe)", "chaperone, ABC1 activity of bc1 complex homolog (S. pombe)"
HGNC name aarF domain containing kinase 3
DDBJ NA
UniProt ADCK3
EC number EC 2.7.11.-Protein-serine/threonine kinases; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000008407
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:56997
KEGG GENES KEGG GENES(56997)
GeneCard GeneCardADCK3*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transferase activity, transferring phosphorus-containing groups (GO:0016772); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  cytoskeleton;  Other; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA241008; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 218168_s_at; 
HG-U133A 218168_s_at; 
HG-U133A_2 218168_s_at; 
HG-U133B NA
HG-U133_Plus_2 218168_s_at; 
HG-U95 45334_at;  64312_at; 
HG-U95A NA
HG-U95B 45334_at; 
HG-U95C 64312_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2383413;  2383416;  2383419;  2383420;  2383421;  2383422;  2383424;  2383425;  2459040; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P85593; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P85598; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
30 .. 30 C/T rs139570869 + CDS Synonymous[Gly10Gly]
49 .. 49 A/G rs180784380 + CDS Nonsynonymous[Ser17Gly]
61 .. 61 A/C rs146751657 + CDS Nonsynonymous[Asn21His]
126 .. 126 C/T rs17849927 + CDS Synonymous[Ile42Ile]
129 .. 129 C/T rs139133094 + CDS Synonymous[Asp43Asp]
134 .. 134 T/C rs199921339 + CDS Nonsynonymous[Leu45Pro]
156 .. 156 G/A rs149048093 + CDS Synonymous[Glu52Glu]
187 .. 187 C/T rs151292389 + CDS Nonsynonymous[Arg63Cys]
192 .. 192 G/A rs202227926 + CDS Synonymous[Lys64Lys]
199 .. 199 G/A rs147097934 + CDS Nonsynonymous[Asp67Asn]
205 .. 205 C/T rs200375779 + CDS Synonymous[Leu69Leu]
227 .. 227 A/G rs144147839 + CDS Nonsynonymous[Tyr76Cys]
273 .. 273 C/T rs138727410 + CDS Synonymous[Thr91Thr]
319 .. 319 A/G rs149364914 + CDS Nonsynonymous[Ser107Gly]
331 .. 331 C/T rs139900636 + CDS Nonsynonymous[Arg111Trp]
337 .. 337 G/A rs201134290 + CDS Nonsynonymous[Glu113Lys]
350 .. 350 A/G rs200800365 + CDS Nonsynonymous[Asn117Ser]
363 .. 363 G/A rs202132812 + CDS Synonymous[Leu121Leu]
371 .. 371 G/- rs34158214 + CDS
381 .. 381 C/T rs12593 - CDS Synonymous[Phe127Phe]
420 .. 420 C/A rs150918577 + CDS Nonsynonymous[Asn140Lys]
474 .. 474 G/A rs201337210 + CDS Synonymous[Thr158Thr]
475 .. 475 C/T rs149682899 + CDS Nonsynonymous[Arg159Trp]
476 .. 476 G/A rs200115323 + CDS Nonsynonymous[Arg159Gln]
482 .. 482 A/G rs119468008 + CDS Nonsynonymous[Tyr161Cys]
497 .. 497 C/G rs141260985 + CDS Nonsynonymous[Thr166Ser]
508 .. 508 A/G rs147730489 + CDS Nonsynonymous[Ile170Val]
532 .. 532 G/A rs200930703 + CDS Nonsynonymous[Asp178Asn]
546 .. 546 G/C rs201158713 + CDS Nonsynonymous[Glu182Asp]
547 .. 547 A/G rs200403220 + CDS Nonsynonymous[Thr183Ala]
551 .. 551 T/G rs199724504 + CDS Nonsynonymous[Val184Gly]
553 .. 553 C/T rs201331131 + CDS Nonsynonymous[Arg185Trp]
558 .. 558 G/A rs142600066 + CDS Synonymous[Ala186Ala]
585 .. 585 C/T rs141423403 + CDS Synonymous[Thr195Thr]
586 .. 586 G/A rs119468009 + CDS Nonsynonymous[Gly196Ser]
592 .. 592 G/A rs119468004 + CDS Nonsynonymous[Glu198Lys]
606 .. 606 G/A rs199874519 + CDS Nonsynonymous[Met202Ile]
613 .. 613 G/A rs142894121 + CDS Nonsynonymous[Ala205Thr]
618 .. 618 C/G rs200963031 + CDS Nonsynonymous[His206Gln]
651 .. 651 C/T rs139305619 + CDS Synonymous[Phe217Phe]
657 .. 657 T/C rs3738725 + CDS Synonymous[Ser219Ser]
661 .. 661 G/A rs202058665 + CDS Nonsynonymous[Glu221Lys]
680 .. 680 C/T rs199581236 + CDS Nonsynonymous[Thr227Ile]
693 .. 693 C/T rs201865243 + CDS Synonymous[Thr231Thr]
696 .. 696 G/C rs201171077 + CDS Nonsynonymous[Glu232Asp]
698 .. 698 A/G rs113308613 + CDS Nonsynonymous[Lys233Arg]
706 .. 706 A/C rs142051104 + CDS Nonsynonymous[Asn236His]
717 .. 717 C/T rs7545723 + CDS Synonymous[Pro239Pro]
738 .. 738 C/T rs139551241 + CDS Synonymous[Leu246Leu]
741 .. 741 C/G rs74589348 + CDS Synonymous[Val247Val]
746 .. 746 C/A/G rs61995958 + CDS
757 .. 757 A/C rs143650593 + CDS Nonsynonymous[Thr253Pro]
762 .. 762 C/T rs201618750 + CDS Synonymous[Tyr254Tyr]
765 .. 765 C/T rs141270350 + CDS Synonymous[Ser255Ser]
807 .. 807 G/A rs191944347 + CDS Synonymous[Lys269Lys]
817 .. 817 C/T rs141725964 + CDS Nonsynonymous[Arg273Cys]
840 .. 840 C/T rs150569155 + CDS Synonymous[Phe280Phe]
841 .. 841 G/A rs149335528 + CDS Nonsynonymous[Glu281Lys]
855 .. 855 C/T rs56043893 + CDS Synonymous[Ser285Ser]
894 .. 894 G/A rs200743857 + 3'UTR
1018 .. 1018 G/A rs149820067 + 3'UTR
1115 .. 1115 G/A rs117808661 + 3'UTR
1119 .. 1119 G/A rs188462608 + 3'UTR
1234 .. 1234 G/A rs113041399 + 3'UTR
1269 .. 1269 G/A rs113631619 + 3'UTR
1270 .. 1270 A/T rs112529851 + 3'UTR
1270 ^ 1271 -/T rs11420839 + 3'UTR
1274 ^ 1275 -/T rs199664948 + 3'UTR
1328 .. 1328 C/G rs12567953 + 3'UTR
1349 .. 1349 A/G rs8159 - 3'UTR
1394 .. 1394 G/A rs142056615 + 3'UTR
1528 .. 1528 G/A rs115542970 + 3'UTR
1541 .. 1541 G/A rs181352749 + 3'UTR
1566 .. 1566 A/G rs10482 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer