H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000028653 Accession number: AL833741 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Motif information
ORF

length(341),orf(886:1911)
MIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEV
ILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLK
NVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIG
MDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIE
DPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLK
VNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQI
KTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK*
a.a.
length
InterPro Name
length(33), motif(1:33) 33 IPR029017 Enolase N-terminal domain-like [Domain]
length(47), motif(1:47) 47 IPR029017 Enolase N-terminal domain-like [Domain]
length(41), motif(1:41) 41 IPR020811 Enolase, N-terminal [Domain]
length(339), motif(1:339) 339 IPR000941 Enolase [Family]
length(17), motif(14:30) 17 IPR000941 Enolase [Family]
length(304), motif(35:338) 304 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(50:338) 289 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(50:338) 289 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(71:84) 14 IPR000941 Enolase [Family]
length(12), motif(224:235) 12 IPR000941 Enolase [Family]
length(14), motif(247:260) 14 IPR020809 Enolase, conserved site [Conserved_site]
length(15), motif(247:261) 15 IPR000941 Enolase [Family]
length(18), motif(276:293) 18 IPR000941 Enolase [Family]