H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000029398 Accession number: BC000163 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Vimentin;
 
 

Motif information
ORF

length(466),orf(125:1525)
MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSR
SLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTR
TNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLY
EEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAE
NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQ
EQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSE
AANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEEN
FAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATY
RKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETR
DGQVINETSQHHDDLE*
a.a.
length
InterPro Name
length(460), motif(7:466) 460 IPR027699 Vimentin [Family]
length(95), motif(7:101) 95 IPR006821 Intermediate filament head, DNA-binding domain [Domain]
length(460), motif(7:466) 460 IPR001664 Intermediate filament protein [Family]
length(309), motif(102:410) 309 IPR001664 Intermediate filament protein [Family]
length(9), motif(397:405) 9 IPR018039 Intermediate filament protein, conserved site [Conserved_site]