H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000029692 Accession number: BC000510 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Heat shock protein beta-1; HspB1; 28 kDa heat shock protein; Estrogen-regulated 24 kDa protein; Heat shock 27 kDa protein; HSP 27; Stress-responsive protein 27; SRP27;
 
 

Transcript original information
Accession number BC000510.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:8509 IMAGE:2822325
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:MGC/NCI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 867[bp] (No. of exon:3)[A:185 T:136 G:234 C:312]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lung, small cell carcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 837(+) Signal: 815-819(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0006788
Genomic location  G-integra Help Chromosome 7
Location 7q11.23
Position 75931931- 75933609
Strand +
Possible duplicated location(s) NA
Gene structure 3 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3315; 
KEGG GENES KEGG GENES(3315); 
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000106127
Predicted CDS 100..717;  205[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.821
Database links RefSeq NP_001531; 
UniProt P04792; 
CCDS CCDS5583; 

Motif information
ORF

length(205),orf(100:717) MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSS WPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD VNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDP TQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSD ETAAK* 		a.a.
length		 InterPro Name
length(29), motif(16:44) 29 IPR008978 HSP20-like chaperone [Domain]
length(13), motif(24:36) 13 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(108), motif(76:183) 108 IPR008978 HSP20-like chaperone [Domain]
length(91), motif(85:175) 91 IPR008978 HSP20-like chaperone [Domain]
length(83), motif(87:169) 83 IPR002068 Alpha crystallin/Hsp20 domain [Domain]
length(97), motif(87:183) 97 IPR002068 Alpha crystallin/Hsp20 domain [Domain]
length(21), motif(89:109) 21 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(14), motif(111:124) 14 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(20), motif(126:145) 20 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(22), motif(148:169) 22 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(16), motif(178:193) 16 IPR001436 Alpha crystallin/Heat shock protein [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000029692
H-Inv cluster ID Locus viewHIX0006788
Accession number BC000510.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Heat shock protein beta-1; HspB1; 28 kDa heat shock protein; Estrogen-regulated 24 kDa protein; Heat shock 27 kDa protein; HSP 27; Stress-responsive protein 27; SRP27;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P04792)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1332886;  1560006;  1730670;  1763035;  2243808;  2295696;  2743305;  3714473;  8093612;  8325890;  8774846;  9110174;  10383393;  10751411;  10777697;  12853948;  14702039;  15122254;  15489334;  15976317;  16548883;  16964243;  17081983;  17924679;  18088087;  18669648;  18691976;  19166925;  19369195;  19464326;  19608861;  20068231;  21269460;  21406692;  22206013;  ALL; 
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ HSPB1
UniProt HSPB1
EC number NA
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000106127
No. of interaction 28
Interaction partner(s) HIP000023960;  HIP000023960;  HIP000024723;  HIP000025121;  HIP000027633;  HIP000027633;  HIP000028809;  HIP000029071;  HIP000030139;  HIP000031195;  HIP000031195;  HIP000031963;  HIP000032546;  HIP000037373;  HIP000039484;  HIP000040680;  HIP000057536;  HIP000061908;  HIP000064456;  HIP000066804;  HIP000070499;  HIP000077087;  HIP000092247;  HIP000092247;  HIP000107319;  HIP000112478;  HIP000112478;  HIP000207868; 
BIND 134094;  199827; 
DIP 112628E;  113149E;  113432E;  113901E;  115103E;  115346E;  116557E;  117119E;  58815E;  754E;  88122E; 
MINT MINT-14024;  MINT-16434;  MINT-16469;  MINT-17168;  MINT-3305331;  MINT-4302652;  MINT-65132;  MINT-65133;  MINT-65134;  MINT-65135;  MINT-65136;  MINT-65137;  MINT-7900157;  MINT-7945693;  MINT-7947479;  MINT-8142240;  MINT-8142253;  MINT-8148722; 
HPRD 00015;  00016;  00030;  00031;  00392;  00427;  00428;  00430;  00435;  00479;  00579;  00604;  01235;  01527;  01818;  01824;  01859;  02202;  02377;  03144;  03183;  03678;  03831;  03842;  03883;  04184;  04256;  04340;  04424;  04593;  06115;  06328;  06420;  06774;  07175;  07414;  07601;  09357;  09467;  10603;  11309;  11882;  13173;  14358;  14382;  15326;  16057;  16246;  17975;  18370; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3315; 
KEGG GENES KEGG GENES(3315); 
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol;  mitochondria;  Other; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
26 168 1gmeA 4e-16 21.5 121/150 b.15.1.1
172 195 1xfhA 4e-04 33.3 24/100 f.49.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator		 AceGene AGhsA261610; 
Affymetrix
GeneChip		 HG-Focus 201841_s_at; 
HG-U133 201841_s_at; 
HG-U133A 201841_s_at; 
HG-U133A_2 201841_s_at; 
HG-U133B NA
HG-U133_Plus_2 201841_s_at; 
HG-U95 36785_at;  63673_at;  90336_at; 
HG-U95A 36785_at; 
HG-U95B NA
HG-U95C 63673_at; 
HG-U95D 90336_at; 
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3009402;  3009403;  3009404;  3009405;  3009406;  3009407;  3009410;  3009412;  3009413;  3009414;  3057647;  3209481;  3209482;  3209483;  3209484;  4008004;  4008010; 
HuGeneFL Z23090_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P257704; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P257704;  A_24_P86537;  A_32_P146552;  A_32_P76247; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator; 

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Charcot-Marie-Tooth disease, axonal, type 2F (606595);  Disease name: Neuropathy, distal hereditary motor, type IIB (608634); 
Related information in OMIM OMIM ID:  602195;  Title: HEAT-SHOCK 27-KD PROTEIN 1
Co-localized orphan diseases NA
Disease related mutation MutationView:  602195; 
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(3315)
Disease Entrez Gene ID:(3315)
Substance Entrez Gene ID:(3315)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo Viewer;  LEGENDALEGENDA; 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
15 ^ 16 -/T rs3842186 - 5'UTR
32 ^ 33 -/ATAAAAGCGCAGCCGAGC rs33964165 + 5'UTR
44 .. 44 C/T rs35759978 + 5'UTR
49 ^ 50 -/ATAAAAGCGCAGCCGAGC rs6150170 + 5'UTR
54 .. 54 C/T rs35907174 + 5'UTR
69 .. 69 T/C rs111293022 + 5'UTR
81 .. 81 C/T rs199602956 + 5'UTR
100 .. 100 A/C rs200190722 + CDS Nonsynonymous[Met1Leu]
108 .. 108 G/A rs77586767 + CDS Synonymous[Glu3Glu]
115 .. 115 G/T rs1049324 + CDS Nonsynonymous[Val6Phe]
117 .. 117 C/T rs11547164 + CDS Synonymous[Val6Val]
123 .. 123 C/T rs201769668 + CDS Synonymous[Phe8Phe]
132 .. 132 G/C rs199712600 + CDS Synonymous[Leu11Leu]
135 .. 135 G/T rs145369859 + CDS Synonymous[Arg12Arg]
137 .. 137 G/C rs1049345 + CDS Nonsynonymous[Gly13Ala]
143 .. 143 G/T rs11547163 + CDS Nonsynonymous[Ser15Ile]
201 .. 201 G/C rs11547166 + CDS Synonymous[Gly34Gly]
222 .. 222 G/T rs11547167 + CDS Nonsynonymous[Glu41Asp]
271 .. 271 C/A rs11547165 + CDS Nonsynonymous[Leu58Met]
277 .. 277 C/T rs61751217 + CDS Nonsynonymous[Pro60Ser]
278 .. 278 C/G rs112075084 + CDS Nonsynonymous[Pro60Arg]
315 .. 315 C/G rs11547168 + CDS Synonymous[Ala72Ala]
337 .. 337 C/A rs1049850 + CDS Nonsynonymous[Gln80Lys]
366 .. 366 G/C rs3190199 + CDS Synonymous[Arg89Arg]
394 .. 394 C/A rs121909113 + CDS Nonsynonymous[Leu99Met]
425 .. 425 T/G rs17850892 + CDS Nonsynonymous[Leu109Arg]
426 .. 426 G/A/C rs112731839 + CDS
460 .. 460 A/T rs17850893 + CDS Nonsynonymous[Thr121Ser]
471 .. 471 C/G rs145243219 + CDS Nonsynonymous[His124Gln]
478 .. 478 C/T rs29001571 + CDS Nonsynonymous[Arg127Trp]
498 .. 498 C/T rs140791936 + CDS Synonymous[Tyr133Tyr]
503 .. 503 C/T rs28939680 + CDS Nonsynonymous[Ser135Phe]
505 .. 505 C/T rs28939681 + CDS Nonsynonymous[Arg136Trp]
517 .. 517 C/G rs121909112 + CDS Nonsynonymous[Arg140Gly]
537 .. 537 C/T rs7805625 + CDS Synonymous[Pro146Pro]
551 .. 551 C/T rs28937568 + CDS Nonsynonymous[Thr151Ile]
571 ^ 572 -/C rs35408134 + CDS
586 .. 586 C/T rs1804841 + CDS Synonymous[Leu163Leu]
597 .. 597 G/C rs148357753 + CDS Nonsynonymous[Glu166Asp]
631 .. 631 G/A rs150110356 + CDS Nonsynonymous[Glu178Lys]
643 .. 643 C/T rs104894020 + CDS Nonsynonymous[Pro182Ser]
644 .. 644 C/T rs28937569 + CDS Nonsynonymous[Pro182Leu]
672 .. 672 T/C rs34771861 + CDS Synonymous[Leu191Leu]
697 .. 697 G/A rs147500292 + CDS Nonsynonymous[Asp200Asn]
708 .. 708 C/T rs199607823 + CDS Synonymous[Ala203Ala]
728 .. 728 C/T rs1058872 + 3'UTR
788 .. 788 T/C rs187491987 + 3'UTR
803 .. 803 C/A rs113923827 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;