H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000029692 Accession number: BC000510 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Heat shock protein beta-1; HspB1; 28 kDa heat shock protein; Estrogen-regulated 24 kDa protein; Heat shock 27 kDa protein; HSP 27; Stress-responsive protein 27; SRP27;
 
 

Motif information
ORF

length(205),orf(100:717)
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSS
WPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD
VNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDP
TQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSD
ETAAK*
a.a.
length
InterPro Name
length(29), motif(16:44) 29 IPR008978 HSP20-like chaperone [Domain]
length(13), motif(24:36) 13 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(108), motif(76:183) 108 IPR008978 HSP20-like chaperone [Domain]
length(91), motif(85:175) 91 IPR008978 HSP20-like chaperone [Domain]
length(83), motif(87:169) 83 IPR002068 Alpha crystallin/Hsp20 domain [Domain]
length(97), motif(87:183) 97 IPR002068 Alpha crystallin/Hsp20 domain [Domain]
length(21), motif(89:109) 21 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(14), motif(111:124) 14 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(20), motif(126:145) 20 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(22), motif(148:169) 22 IPR001436 Alpha crystallin/Heat shock protein [Family]
length(16), motif(178:193) 16 IPR001436 Alpha crystallin/Heat shock protein [Family]