H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030017 Accession number: BC000938 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: X-box-binding protein 1; XBP-1; Tax-responsive element-binding protein 5;
 
 

Motif information
ORF

length(261),orf(6:791)
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEA
ASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQ
QVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEA
KGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQS
LISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWG
RHQPSWKPLMN*
a.a.
length
InterPro Name
length(65), motif(68:132) 65 IPR004827 Basic-leucine zipper domain [Domain]
length(52), motif(69:120) 52 IPR004827 Basic-leucine zipper domain [Domain]
length(64), motif(70:133) 64 IPR004827 Basic-leucine zipper domain [Domain]
length(16), motif(75:90) 16 IPR004827 Basic-leucine zipper domain [Domain]