H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030422_03 Accession number: BC001449 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Heterogeneous nuclear ribonucleoprotein R; hnRNP R;
 
 

Transcript original information
Accession number BC001449.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:2039 IMAGE:3139052
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2713[bp] (No. of exon:11)[A:834 T:703 G:688 C:488]
Devision NA
Molecular type NA
Library origin Cell type NA
Tissue type Placenta, choriocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2694(+) Signal: 2664-2668(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGCAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0213791
Genomic location  G-integra Help Chromosome 1
Location 1p36.12
Position 23636276- 23670803
Strand -
Possible duplicated location(s) NA
Gene structure 11 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10236
KEGG GENES KEGG GENES(10236)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000030803
Predicted CDS 110..2020;  636[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.728
Database links RefSeq NP_001095868
UniProt NA
CCDS CCDS44085

Motif information
ORF

length(636),orf(110:2020)
MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIF
QTGLVAYVDLDERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCG
VMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGP
PPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDP
LSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFV
GSIPKNKTKENILEEFSKVTGLTEGLVDVILYHQPDDKKKNRGFCFLEYE
DHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRN
LATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGK
EIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIR
GRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGY
AVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRG
GPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQ
PIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK*
a.a.
length
InterPro Name
length(526), motif(106:631) 526 IPR006535 HnRNP R/Q splicing factor [Family]
length(80), motif(165:244) 80 IPR000504 RNA recognition motif domain [Domain]
length(75), motif(166:240) 75 IPR000504 RNA recognition motif domain [Domain]
length(65), motif(167:231) 65 IPR000504 RNA recognition motif domain [Domain]
length(160), motif(168:327) 160 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(86), motif(246:331) 86 IPR000504 RNA recognition motif domain [Domain]
length(81), motif(247:327) 81 IPR000504 RNA recognition motif domain [Domain]
length(65), motif(248:312) 65 IPR000504 RNA recognition motif domain [Domain]
length(96), motif(328:423) 96 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(71), motif(344:414) 71 IPR000504 RNA recognition motif domain [Domain]
length(66), motif(345:410) 66 IPR000504 RNA recognition motif domain [Domain]
length(62), motif(346:407) 62 IPR000504 RNA recognition motif domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000030422_03
H-Inv cluster ID Locus viewHIX0213791
Accession number BC001449.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Heterogeneous nuclear ribonucleoprotein R; hnRNP R;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (O43390)  [Identity/coverage = 99.528%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 942149711991638154893341671041417289661196088612126946021515746ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ HNRPR
UniProt HNRNPR
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000030803
No. of interaction 24
Interaction partner(s) HIP000007989HIP000023587HIP000024702HIP000024702HIP000027819HIP000027819HIP000030029HIP000030029HIP000040680HIP000057536HIP000060266HIP000063360HIP000071861HIP000078197HIP000078197HIP000079240HIP000085548HIP000089618HIP000092247HIP000092247HIP000100089HIP000166562HIP000168212HIP000192131
BIND NA
DIP 113389E;  131722E;  131894E;  131915E;  132227E;  132267E;  144760E; 
MINT MINT-5205872;  MINT-65366;  MINT-65367;  MINT-65368;  MINT-7945693;  MINT-8076071;  MINT-8110455; 
HPRD 00535;  00589;  01095;  01809;  02740;  02877;  03144;  03465;  04227;  04340;  04746;  05496;  07601;  14358;  16246; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10236
KEGG GENES KEGG GENES(10236)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function nucleic acid binding (GO:0003676);  nucleotide binding (GO:0000166); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) AK147043 MGI:3572161 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC056750 G-integraG-integra
Orthology Bos sp. (Cow) BC133299 G-integraG-integra
Orthology Pongo sp. (Orangutan) CR860678 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000021145 G-integraG-integra
Orthology Macaca sp. (Macaque) ENSMMUT00000015348 G-integraG-integra
Orthology Monodelphis sp. (Opossum) ENSMODT00000020522 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000003124 G-integraG-integra
Orthology Rattus sp. (Rat) ENSRNOT00000016001 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00032611001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000157216 G-integraG-integra
Orthology Equus sp. (Horse) XM_001501425 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_513191 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
1 .. 1 C/G rs12409193 - 5'UTR
2 .. 2 A/- rs35952129 - 5'UTR
87 .. 87 C/T rs113761299 - 5'UTR
222 .. 222 T/C rs145180459 - CDS Nonsynonymous[Leu38Pro]
269 .. 269 T/C rs112936104 - CDS Synonymous[Leu54Leu]
306 .. 306 A/G rs111438915 - CDS Nonsynonymous[Asp66Gly]
520 .. 520 T/C rs183334101 - CDS Synonymous[Thr137Thr]
584 .. 584 G/A rs200996181 - CDS Nonsynonymous[Val159Met]
603 .. 603 C/T rs142602286 - CDS Nonsynonymous[Thr165Met]
649 .. 649 G/A rs140549444 - CDS Synonymous[Glu180Glu]
691 .. 691 A/G rs142539327 - CDS Synonymous[Leu194Leu]
713 .. 713 T/G rs201702161 - CDS Nonsynonymous[Ser202Ala]
742 .. 742 C/T rs146654915 - CDS Synonymous[Ile211Ile]
745 .. 745 C/T rs200469820 - CDS Synonymous[Thr212Thr]
755 .. 755 A/G rs200948069 - CDS Nonsynonymous[Lys216Glu]
869 .. 869 C/A rs77029355 - CDS Nonsynonymous[Pro254Thr]
871 .. 871 G/A rs141121420 - CDS Synonymous[Pro254Pro]
901 .. 901 A/G rs200114895 - CDS Synonymous[Glu264Glu]
914 .. 914 G/A rs200798900 - CDS Nonsynonymous[Val269Ile]
1075 .. 1075 T/C rs202044339 - CDS Synonymous[Asn322Asn]
1219 .. 1219 C/T rs34061540 - CDS Synonymous[Leu370Leu]
1261 .. 1261 T/- rs35216187 - CDS
1354 .. 1354 A/G rs199598063 - CDS Synonymous[Pro415Pro]
1407 .. 1407 C/A rs180897497 - CDS Nonsynonymous[Ala433Glu]
1433 .. 1433 C/T rs200321081 - CDS Nonsynonymous[Pro442Ser]
1451 .. 1451 C/T rs201334404 - CDS Nonsynonymous[Pro448Ser]
1454 .. 1454 A/G rs201330041 - CDS Nonsynonymous[Ile449Val]
1498 .. 1498 C/A rs201164560 - CDS AA-STOP[Tyr463*]
1513 .. 1513 C/T rs202066167 - CDS Synonymous[Tyr468Tyr]
1683 .. 1683 C/T rs12747047 - CDS Nonsynonymous[Pro525Leu]
1684 .. 1684 T/C rs12729576 - CDS Synonymous[Pro525Pro]
1706 .. 1706 T/A rs149942635 - CDS Nonsynonymous[Ser533Thr]
1716 .. 1716 G/T rs200585538 - CDS Nonsynonymous[Gly536Val]
1718 .. 1718 G/- rs35459559 - CDS
1793 .. 1793 C/T rs150851244 - CDS Nonsynonymous[Arg562Cys]
1869 .. 1869 A/G rs200983805 - CDS Nonsynonymous[Lys587Arg]
1891 .. 1891 A/G rs201881520 - CDS Synonymous[Gln594Gln]
1915 .. 1915 C/T rs147254283 - CDS Synonymous[Ile602Ile]
1967 .. 1967 A/C rs662879 - CDS Nonsynonymous[Asn620His]
2013 .. 2013 G/A rs1801929 + CDS AA-STOP[Trp635*]
2056 .. 2056 C/T/G rs199969932 - 3'UTR
2326 .. 2326 T/G rs188993490 - 3'UTR
2329 .. 2329 A/C rs141955499 - 3'UTR
2334 .. 2334 C/G rs185733680 - 3'UTR
2456 .. 2456 A/G rs1801930 + 3'UTR
2612 .. 2612 A/G rs181814727 - 3'UTR
2621 .. 2621 T/C rs56097660 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer