H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030422_03 Accession number: BC001449 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Heterogeneous nuclear ribonucleoprotein R; hnRNP R;
 
 

Motif information
ORF

length(636),orf(110:2020)
MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIF
QTGLVAYVDLDERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCG
VMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGP
PPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDP
LSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFV
GSIPKNKTKENILEEFSKVTGLTEGLVDVILYHQPDDKKKNRGFCFLEYE
DHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRN
LATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGK
EIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIR
GRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGY
AVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRG
GPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQ
PIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK*
a.a.
length
InterPro Name
length(526), motif(106:631) 526 IPR006535 HnRNP R/Q splicing factor [Family]
length(80), motif(165:244) 80 IPR000504 RNA recognition motif domain [Domain]
length(75), motif(166:240) 75 IPR000504 RNA recognition motif domain [Domain]
length(65), motif(167:231) 65 IPR000504 RNA recognition motif domain [Domain]
length(160), motif(168:327) 160 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(86), motif(246:331) 86 IPR000504 RNA recognition motif domain [Domain]
length(81), motif(247:327) 81 IPR000504 RNA recognition motif domain [Domain]
length(65), motif(248:312) 65 IPR000504 RNA recognition motif domain [Domain]
length(96), motif(328:423) 96 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(71), motif(344:414) 71 IPR000504 RNA recognition motif domain [Domain]
length(66), motif(345:410) 66 IPR000504 RNA recognition motif domain [Domain]
length(62), motif(346:407) 62 IPR000504 RNA recognition motif domain [Domain]