H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030461 Accession number: BC001505 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Retinal dehydrogenase 1; RALDH 1; RalDH1; EC=1.2.1.36; ALDH-E1; ALHDII; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase, cytosolic;
 
 

Transcript original information
Accession number BC001505.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:2318 IMAGE:2988388
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2088[bp] (No. of exon:13)[A:650 T:572 G:478 C:388]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Colon, adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2068(+) Signal: 2048-2052(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0008099
Genomic location  G-integra Help Chromosome 9
Location 9q21.13
Position 75515587- 75567941
Strand -
Possible duplicated location(s) NA
Gene structure 13 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:216
KEGG GENES KEGG GENES(216)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000103486
Predicted CDS 26..1531;  501[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.739
Database links RefSeq NP_000680
UniProt P00352
CCDS CCDS6644

Motif information
ORF

length(501),orf(26:1531)
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELC
QVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDR
LLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGN
FFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPL
TALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEV
GKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEE
IFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAG
TVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKN
S*
a.a.
length
InterPro Name
length(484), motif(13:496) 484 IPR016161 Aldehyde/histidinol dehydrogenase [Domain]
length(262), motif(20:281) 262 IPR016162 Aldehyde dehydrogenase N-terminal domain [Domain]
length(464), motif(29:492) 464 IPR015590 Aldehyde dehydrogenase domain [Domain]
length(8), motif(268:275) 8 IPR029510 Aldehyde dehydrogenase, glutamic acid active site [Conserved_site]
length(186), motif(282:467) 186 IPR016163 Aldehyde dehydrogenase, C-terminal [Domain]
length(12), motif(296:307) 12 IPR016160 Aldehyde dehydrogenase, cysteine active site [Conserved_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000030461
H-Inv cluster ID Locus viewHIX0008099
Accession number BC001505.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Retinal dehydrogenase 1; RALDH 1; RalDH1; EC=1.2.1.36; ALDH-E1; ALHDII; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase, cytosolic;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P00352)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 2591967277671429879443676276401582367236598214422849391415164053154893341960886121269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ ALDH1A1
UniProt ALDH1A1
EC number EC 1.2.1.36retinal dehydrogenase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00830 :Retinol metabolism; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000103486
No. of interaction 4
Interaction partner(s) HIP000009209HIP000024696HIP000070921HIP000071861
BIND NA
DIP NA
MINT NA
HPRD 00003; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:216
KEGG GENES KEGG GENES(216)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620);  oxidoreductase activity (GO:0016491); 
Biological process metabolic process (GO:0008152); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  cytoskeleton;  nuclear;  plasma membrane; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
15 495 1uzbA e-138 34.1 472/516 c.82.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA190605; 
Affymetrix
GeneChip
HG-Focus 212224_at; 
HG-U133 212224_at; 
HG-U133A 212224_at; 
HG-U133A_2 212224_at; 
HG-U133B NA
HG-U133_Plus_2 212224_at; 
HG-U95 37015_at; 
HG-U95A 37015_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3174768;  3209736;  3209737;  3209738;  3209742;  3209743;  3209744;  3209746;  3209748;  3209752;  3209753;  3209755;  3209756;  3209757;  3209759;  3209762; 
HuGeneFL M31994_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P83098; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P83098; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
10 .. 10 A/- rs8187867 + 5'UTR
42 .. 42 C/T rs144704960 - CDS Nonsynonymous[Thr6Met]
55 .. 55 T/C rs149765893 - CDS Synonymous[Pro10Pro]
68 .. 68 G/T rs11554424 + CDS Nonsynonymous[Asp15Tyr]
69 .. 69 A/G rs146880290 - CDS Nonsynonymous[Asp15Gly]
107 .. 107 G/A rs139444933 - CDS Nonsynonymous[Glu28Lys]
113 .. 113 C/A rs146262229 - CDS Nonsynonymous[His30Asn]
130 .. 130 C/A rs150630972 - CDS Synonymous[Gly35Gly]
142 .. 142 T/C rs11554422 + CDS Synonymous[Pro39Pro]
144 .. 144 T/C rs11554426 + CDS Nonsynonymous[Val40Ala]
250 .. 250 C/T rs13959 + CDS Synonymous[Ser75Ser]
252 .. 252 C/G rs150537821 - CDS Nonsynonymous[Pro76Arg]
260 .. 260 A/G rs201862815 - CDS Nonsynonymous[Thr79Ala]
280 .. 280 G/C rs202024021 - CDS Nonsynonymous[Arg85Ser]
298 .. 298 G/A rs141702925 - CDS Synonymous[Lys91Lys]
337 .. 337 G/A rs200911247 - CDS Synonymous[Ala104Ala]
347 .. 347 T/A rs201385375 - CDS Nonsynonymous[Ser108Thr]
372 .. 372 C/T rs200465513 - CDS Nonsynonymous[Ser116Phe]
376 .. 376 T/C rs148006185 - CDS Synonymous[Asn117Asn]
387 .. 387 A/G rs1049981 + CDS Nonsynonymous[Asn121Ser]
398 .. 398 G/C rs11554423 + CDS Nonsynonymous[Gly125Arg]
412 .. 412 A/G rs200315162 - CDS Synonymous[Thr129Thr]
414 .. 414 T/C rs192879914 - CDS Nonsynonymous[Leu130Ser]
417 .. 417 G/A rs188688581 - CDS Nonsynonymous[Arg131His]
452 .. 452 C/T rs143464638 - CDS Nonsynonymous[Arg143Cys]
453 .. 453 G/A rs149236405 - CDS Nonsynonymous[Arg143His]
481 .. 481 T/A rs139374917 - CDS Nonsynonymous[Phe152Leu]
554 .. 554 A/T rs8187929 + CDS Nonsynonymous[Ile177Phe]
565 .. 565 A/G rs200452607 - CDS Nonsynonymous[Ile180Met]
574 .. 574 A/C rs146885014 - CDS Synonymous[Ala183Ala]
594 .. 594 T/C rs142547395 - CDS Nonsynonymous[Val190Ala]
595 .. 595 G/T rs147729972 - CDS Synonymous[Val190Val]
669 .. 669 C/T rs142480764 - CDS Nonsynonymous[Pro215Leu]
686 .. 686 A/G rs199833382 - CDS Nonsynonymous[Ile221Val]
769 .. 769 A/T rs11554425 + CDS Synonymous[Thr248Thr]
866 .. 866 G/A rs201404630 - CDS Nonsynonymous[Asp281Asn]
886 .. 886 T/C rs199745432 - CDS Synonymous[Ala287Ala]
904 .. 904 T/C rs150455539 - CDS Synonymous[His293His]
934 .. 934 T/C rs140513949 - CDS Synonymous[Cys303Cys]
962 .. 962 G/A rs151269980 - CDS Nonsynonymous[Glu313Lys]
1008 .. 1008 A/C rs186527997 - CDS Nonsynonymous[Lys328Thr]
1147 .. 1147 G/A rs202153674 - CDS Synonymous[Pro374Pro]
1161 .. 1161 G/C rs142280224 - CDS Nonsynonymous[Gly379Ala]
1202 .. 1202 G/A rs190750432 - CDS Nonsynonymous[Glu393Lys]
1204 .. 1204 G/C rs200416331 - CDS Nonsynonymous[Glu393Asp]
1237 .. 1237 A/G rs61995942 - CDS Synonymous[Pro404Pro]
1254 ^ 1255 -/G rs5898283 - CDS
1335 .. 1335 T/C rs200885470 - CDS Nonsynonymous[Ile437Thr]
1361 .. 1361 G/A rs146756445 - CDS Nonsynonymous[Ala446Thr]
1362 .. 1362 C/A rs1803054 + CDS Nonsynonymous[Ala446Asp]
1379 .. 1379 G/C rs185575721 - CDS Nonsynonymous[Val452Leu]
1400 .. 1400 G/A rs143437440 - CDS Nonsynonymous[Val459Met]
1422 .. 1422 T/A rs1063447 + CDS Nonsynonymous[Phe466Tyr]
1489 .. 1489 G/A rs139965768 - CDS Synonymous[Glu488Glu]
1530 .. 1530 A/G rs144085228 - CDS Synonymous_atSTOP[*502*]
1593 .. 1593 A/G rs8187998 + 3'UTR
1603 .. 1603 T/C rs186712273 - 3'UTR
1616 .. 1616 T/G rs115294789 - 3'UTR
1735 ^ 1736 -/C rs34476430 - 3'UTR
1771 .. 1771 T/A rs77252691 + 3'UTR
1846 .. 1846 G/C rs8187999 + 3'UTR
1872 .. 1872 T/C rs15500 + 3'UTR
1986 .. 1986 A/G rs8188000 + 3'UTR
1991 .. 1991 T/C rs148290597 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer