H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030666 Accession number: BC001810 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Transcript original information
Accession number BC001810.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:2414 IMAGE:2906988
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ENO1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ENO1);
Sequence data provider Provider:MGC/NCI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 1743[bp] (No. of exon:12)[A:420 T:385 G:476 C:462]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Placenta, choriocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1725(+) Signal: 1699-1703(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000101
Genomic location  G-integra Help Chromosome 1
Location 1p36.23
Position 8921062- 8938692
Strand -
Possible duplicated location(s) NA
Gene structure 12 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023; 
KEGG GENES KEGG GENES(2023); 
GeneCard GeneCardENO1;  *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000099039
Predicted CDS 64..1368;  434[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.806
Database links RefSeq NP_001419; 
UniProt P06733; 
CCDS CCDS97; 

Motif information
ORF

length(434),orf(64:1368) MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK* 		a.a.
length		 InterPro Name
length(432), motif(1:432) 432 IPR000941 Enolase [Family]
length(124), motif(3:126) 124 IPR029017 Enolase N-terminal domain-like [Domain]
length(136), motif(3:138) 136 IPR029017 Enolase N-terminal domain-like [Domain]
length(132), motif(3:134) 132 IPR020811 Enolase, N-terminal [Domain]
length(427), motif(3:429) 427 IPR000941 Enolase [Family]
length(15), motif(35:49) 15 IPR000941 Enolase [Family]
length(17), motif(107:123) 17 IPR000941 Enolase [Family]
length(304), motif(128:431) 304 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(164:177) 14 IPR000941 Enolase [Family]
length(12), motif(317:328) 12 IPR000941 Enolase [Family]
length(14), motif(340:353) 14 IPR020809 Enolase, conserved site [Conserved_site]
length(15), motif(340:354) 15 IPR000941 Enolase [Family]
length(18), motif(369:386) 18 IPR000941 Enolase [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000030666
H-Inv cluster ID Locus viewHIX0000101
Accession number BC001810.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P06733)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1369209;  2005901;  2373081;  3529090;  7787969;  8824716;  9110174;  9150948;  9308760;  9653645;  9878089;  10082554;  10681589;  10802057;  11134351;  11497239;  12297304;  12666133;  14702039;  15489334;  15592455;  16139798;  16548883;  16710414;  16815975;  17974005;  18669648;  19608861;  19690332;  20068231;  21269460;  21908771;  ALL; 
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ENO1
HGNC aliases NA
HGNC name enolase 1, (alpha)
DDBJ ENO1
UniProt ENO1
EC number EC 4.2.1.11phosphopyruvate hydratase; 
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00010 :Glycolysis / Gluconeogenesis;  00400 :Phenylalanine, tyrosine and tryptophan biosynthesis; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000099039
No. of interaction 5
Interaction partner(s) HIP000034294;  HIP000082842;  HIP000091335;  HIP000120293;  HIP000136154; 
BIND 145679; 
DIP 133943E;  180033E; 
MINT MINT-2858506;  MINT-3304712;  MINT-49071;  MINT-49243;  MINT-51023;  MINT-7995173;  MINT-7995182;  MINT-7995334; 
HPRD 00010;  00017;  00032;  01417;  01456;  03183;  03229;  03387;  03465;  04078;  04585;  05496;  07601;  08442;  09113;  10584;  14358;  16050;  16246; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023; 
KEGG GENES KEGG GENES(2023); 
GeneCard GeneCardENO1;  *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function phosphopyruvate hydratase activity (GO:0004634);  magnesium ion binding (GO:0000287); 
Biological process glycolysis (GO:0006096); 
Cellular component phosphopyruvate hydratase complex (GO:0000015); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
3 139 1e9iA2 2e-59 63.7 135/139 d.54.1.1
141 431 1e9iA1 3e-81 48.4 285/291 c.1.11.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator		 AceGene NA
Affymetrix
GeneChip		 HG-Focus 201231_s_at; 
HG-U133 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133B NA
HG-U133_Plus_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U95 2035_s_at; 
HG-U95A 2035_s_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2319118;  2395498;  2395499;  2395503;  2395504;  2395505;  2395507;  2395510;  2395518; 
HuGeneFL M14328_s_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P105501;  A_32_P229365; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator; 

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name:NA
Related information in OMIM OMIM ID:  172430;  Title: ENOLASE 1
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(2023)
Disease Entrez Gene ID:(2023)
Substance Entrez Gene ID:(2023)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo Viewer;  LEGENDALEGENDA; 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
19 .. 19 C/T rs11544506 + 5'UTR
25 .. 25 C/T rs11544510 + 5'UTR
107 .. 107 G/T rs11544495 + CDS Nonsynonymous[Arg15Leu]
188 .. 188 G/C rs11544503 + CDS Nonsynonymous[Gly42Ala]
194 .. 194 A/G rs138834005 - CDS Nonsynonymous[Tyr44Cys]
230 .. 230 G/A rs201990176 - CDS Nonsynonymous[Arg56His]
238 .. 238 G/A rs142310173 - CDS Nonsynonymous[Gly59Arg]
264 .. 264 G/A rs28999074 + CDS Synonymous[Glu67Glu]
267 .. 267 C/T rs201513751 - CDS Synonymous[His68His]
272 .. 272 A/G rs201867667 - CDS Nonsynonymous[Asn70Ser]
286 .. 286 C/A rs146938354 - CDS Nonsynonymous[Pro75Thr]
294 .. 294 G/A rs28999075 + CDS Synonymous[Leu77Leu]
295 .. 295 G/T rs146619828 - CDS Nonsynonymous[Val78Phe]
345 .. 345 G/C rs11544491 + CDS Nonsynonymous[Met94Ile]
356 .. 356 A/G rs201943492 - CDS Nonsynonymous[Asp98Gly]
387 .. 387 G/A rs200935067 - CDS Synonymous[Ala108Ala]
415 .. 415 G/A rs199529530 - CDS Nonsynonymous[Val118Ile]
420 .. 420 C/T rs11544507 + CDS Synonymous[Cys119Cys]
433 .. 433 G/A/C rs11544519 + CDS
459 ^ 460 -/CC rs144538182 - CDS
462 .. 462 C/T rs11544497 + CDS Synonymous[His133His]
480 .. 480 C/A rs142256351 - CDS Synonymous[Gly139Gly]
558 .. 558 G/C rs11544509 + CDS Nonsynonymous[Met165Ile]
594 .. 594 C/A/T rs11544513 + CDS
630 .. 630 C/T rs11544499 + CDS Synonymous[Tyr189Tyr]
632 .. 632 A/G rs201627070 - CDS Nonsynonymous[His190Arg]
649 .. 649 A/G rs199771237 - CDS Nonsynonymous[Ile196Val]
697 .. 697 G/A rs201238976 - CDS Nonsynonymous[Gly212Arg]
773 .. 773 C/T rs148752848 - CDS Nonsynonymous[Thr237Ile]
787 .. 787 A/G rs138820314 - CDS Nonsynonymous[Ile242Val]
790 .. 790 G/A rs143707545 - CDS Nonsynonymous[Gly243Ser]
798 .. 798 C/G/T rs2230874 + CDS
803 .. 803 C/T rs201508705 - CDS Nonsynonymous[Ala247Val]
810 .. 810 C/T rs143076849 - CDS Synonymous[Ser249Ser]
811 .. 811 G/C/T rs11544512 + CDS
960 .. 960 T/C rs140944386 - CDS Synonymous[Asp299Asp]
1037 .. 1037 C/A rs11544514 + CDS Nonsynonymous[Pro325Gln]
1038 .. 1038 A/C rs140674283 - CDS Synonymous[Pro325Pro]
1050 .. 1050 C/A rs3180139 + CDS Synonymous[Ala329Ala]
1062 .. 1062 C/T rs146867004 - CDS Synonymous[Asn333Asn]
1127 .. 1127 A/C rs201636531 - CDS Nonsynonymous[Gln355Pro]
1133 .. 1133 G/A rs200008125 - CDS Nonsynonymous[Cys357Tyr]
1151 .. 1151 A/G rs151047591 - CDS Nonsynonymous[Asn363Ser]
1177 .. 1177 C/T rs150781341 - CDS Nonsynonymous[Arg372Cys]
1181 .. 1181 C/T rs143592223 - CDS Nonsynonymous[Ser373Leu]
1186 .. 1186 G/A rs3206672 + CDS Nonsynonymous[Glu375Lys]
1222 .. 1222 G/C rs11544489 + CDS Nonsynonymous[Gly387Arg]
1271 .. 1271 G/A rs201032262 - CDS Nonsynonymous[Arg403His]
1301 .. 1301 T/C rs201317089 - CDS Nonsynonymous[Ile413Thr]
1311 .. 1311 G/A rs193006639 - CDS Synonymous[Glu416Glu]
1356 .. 1356 C/T rs1065722 + CDS Synonymous[Pro431Pro]
1362 .. 1362 C/A rs139671695 - CDS Synonymous[Ala433Ala]
1368 .. 1368 A/G rs138375821 - CDS Synonymous_atSTOP[*435*]
1385 .. 1385 C/G rs1065725 + 3'UTR
1419 .. 1419 C/T rs11544498 + 3'UTR
1423 .. 1423 C/G rs3207089 + 3'UTR
1458 .. 1458 C/A rs3211543 + 3'UTR
1490 .. 1490 A/C rs3206703 + 3'UTR
1492 .. 1492 C/T rs11544504 + 3'UTR
1543 ^ 1544 -/C rs35715680 - 3'UTR
1576 .. 1576 C/T rs3206709 + 3'UTR
1593 .. 1593 T/A rs28999102 + 3'UTR
1612 .. 1612 A/C rs3199777 + 3'UTR
1619 .. 1619 A/C rs1065737 + 3'UTR
1631 .. 1631 G/A rs1059149 + 3'UTR
1651 .. 1651 C/T rs1803537 + 3'UTR
1654 .. 1654 C/T rs1059176 + 3'UTR
1667 .. 1667 A/C rs3206710 + 3'UTR
1720 .. 1720 A/G rs113945549 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;