H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030868 Accession number: BC002406 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; EC=1.2.4.1; PDHE1-A type I; Precursor;
 
 

Motif information
ORF

length(390),orf(58:1230)
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP
PVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEAC
CVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKG
GSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAAN
QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIP
GLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAA
QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS*
a.a.
length
InterPro Name
length(350), motif(36:385) 350 IPR029061 Thiamin diphosphate-binding fold [Domain]
length(335), motif(49:383) 335 IPR029061 Thiamin diphosphate-binding fold [Domain]
length(311), motif(59:369) 311 IPR017597 Pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit, subgroup y [Family]
length(295), motif(67:361) 295 IPR001017 Dehydrogenase, E1 component [Domain]