H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030980 Accession number: BC002545 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Serine/threonine-protein phosphatase 2A activator isoform b.
 
 

Transcript original information
Accession number BC002545.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:2184 IMAGE:3138990
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PPP2R4) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PPP2R4);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2666[bp] (No. of exon:11)[A:504 T:593 G:799 C:770]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Placenta, choriocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2650(+) Signal: 2625-2629(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0018690
Genomic location  G-integra Help Chromosome 9
Location 9q34.11
Position 131873244- 131911223
Strand +
Possible duplicated location(s) NA
Gene structure 11 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5524
KEGG GENES KEGG GENES(5524)
GeneCard GeneCardPPP2R4*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000102985
Predicted CDS 48..1169;  373[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.809

Motif information
ORF

length(373),orf(48:1169)
MSSKLLEPAGAHLSSGSSEPLVEPGRGRVGARVKGERGLQASGSAPGRSK
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIG
FILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRF
GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRID
YGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYR
MEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKD
YMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL
EKFPVIQHFKFGSLLPIHPVTSG*
a.a.
length
InterPro Name
length(325), motif(49:373) 325 IPR004327 Phosphotyrosyl phosphatase activator, PTPA [Family]
length(295), motif(76:370) 295 IPR004327 Phosphotyrosyl phosphatase activator, PTPA [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000030980
H-Inv cluster ID Locus viewHIX0018690
Accession number BC002545.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Serine/threonine-protein phosphatase 2A activator isoform b.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_066954)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PPP2R4
HGNC aliases "protein phosphatase 2A, regulatory subunit B' (PR 53)"
HGNC name protein phosphatase 2A activator, regulatory subunit 4
DDBJ PPP2R4
UniProt NA
EC number EC 5.2.1.8peptidylprolyl isomerase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 04020 :Calcium signaling pathway; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000102985
No. of interaction 2
Interaction partner(s) HIP000117203HIP000162615
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5524
KEGG GENES KEGG GENES(5524)
GeneCard GeneCardPPP2R4*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR073251
Accession
Description
Location
PMID
FR ID FR109630
Accession
Description
Location
PMID
FR ID FR210113
Accession
Description
Location
PMID
FR ID FR243529
Accession
Description
Location
PMID
FR ID FR249598
Accession
Description
Location
PMID
FR ID FR306990
Accession
Description
Location
PMID
FR ID FR393377
Accession
Description
Location
PMID
FR ID FR397617
Accession
Description
Location
PMID
FR ID FR403037
Accession
Description
Location
PMID

Gene ontology information
Molecular function phosphatase activator activity (GO:0019211); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  plasma membrane;  Other; 
Target P Other
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
72 372 2g62A1 e-139 96.3 295/295 a.268.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA041112; 
Affymetrix
GeneChip
HG-Focus 208874_x_at; 
HG-U133 206452_x_at;  208874_x_at; 
HG-U133A 206452_x_at;  208874_x_at; 
HG-U133A_2 206452_x_at;  208874_x_at; 
HG-U133B NA
HG-U133_Plus_2 206452_x_at;  208874_x_at; 
HG-U95 39127_f_at; 
HG-U95A 39127_f_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3190940;  3190944;  3190945;  3190946;  3190947;  3190949;  3190950;  3190951;  3190952;  3190953;  3190960;  3190967;  3190968; 
HuGeneFL X73478_at;  X86428_s_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
13 .. 13 A/C rs3118625 + 5'UTR
17 .. 17 C/T rs113217898 + 5'UTR
59 .. 59 G/C rs145868232 + CDS Nonsynonymous[Lys4Asn]
76 .. 76 G/A rs138663606 + CDS Nonsynonymous[Gly10Asp]
203 .. 203 T/C rs60764362 + CDS Synonymous[Ala52Ala]
248 .. 248 T/C rs202118607 + CDS Synonymous[Pro67Pro]
280 .. 280 A/G rs17481693 + CDS Nonsynonymous[Lys78Arg]
292 .. 292 C/T rs147961453 + CDS Nonsynonymous[Thr82Ile]
318 .. 318 C/T rs200345986 + CDS Nonsynonymous[Arg91Cys]
319 .. 319 G/A rs189327703 + CDS Nonsynonymous[Arg91His]
354 .. 354 C/T rs149371076 + CDS Nonsynonymous[Leu103Phe]
360 .. 360 C/A rs11554661 + CDS Nonsynonymous[Leu105Ile]
410 .. 410 C/T rs147044679 + CDS Synonymous[Ser121Ser]
429 .. 429 G/C rs1131987 + CDS Nonsynonymous[Val128Leu]
445 .. 445 C/T rs200309124 + CDS Nonsynonymous[Thr133Met]
476 .. 476 A/G rs200646201 + CDS Synonymous[Pro143Pro]
523 .. 523 A/G rs200340392 + CDS Nonsynonymous[Tyr159Cys]
585 .. 585 G/A rs201935031 + CDS Nonsynonymous[Ala180Thr]
593 .. 593 G/T rs145486754 + CDS Synonymous[Val182Val]
632 .. 632 C/T rs140351460 + CDS Synonymous[Asn195Asn]
715 .. 715 G/A rs4836639 + CDS Nonsynonymous[Arg223Gln]
723 .. 723 G/A rs34643669 + CDS Nonsynonymous[Asp226Asn]
745 .. 745 A/C rs138155879 + CDS Nonsynonymous[Lys233Thr]
754 .. 754 A/G rs142643111 + CDS Nonsynonymous[Asn236Ser]
776 .. 776 G/A rs143681457 + CDS Synonymous[Arg243Arg]
785 .. 785 G/A rs35481042 + CDS Synonymous[Gln246Gln]
809 .. 809 C/T rs17508881 + CDS Synonymous[Ala254Ala]
832 .. 832 T/C rs201651829 + CDS Nonsynonymous[Leu262Pro]
860 .. 860 C/G rs141469321 + CDS Nonsynonymous[Ile271Met]
875 .. 875 G/A rs141815672 + CDS Synonymous[Gln276Gln]
882 .. 882 G/A rs112063689 + CDS Nonsynonymous[Asp279Asn]
926 .. 926 C/T rs150647017 + CDS Synonymous[Ala293Ala]
932 .. 932 T/C rs201904712 + CDS Synonymous[Asn295Asn]
947 .. 947 C/G rs200171889 + CDS Nonsynonymous[Asp300Glu]
950 .. 950 C/T rs140781354 + CDS Synonymous[Tyr301Tyr]
999 .. 999 T/C rs201011473 + CDS Nonsynonymous[Phe318Leu]
1037 .. 1037 C/T rs11554659 + CDS Synonymous[Ala330Ala]
1040 .. 1040 C/G rs1051946 + CDS Synonymous[Val331Val]
1041 .. 1041 C/T rs147505217 + CDS Nonsynonymous[Pro332Ser]
1092 .. 1092 T/A rs201522942 + CDS Nonsynonymous[Cys349Ser]
1137 .. 1137 C/G rs140244152 + CDS Nonsynonymous[Leu364Val]
1159 .. 1159 C/T rs150059994 + CDS Nonsynonymous[Thr371Met]
1162 .. 1162 C/T rs2480452 - CDS Nonsynonymous[Ser372Leu]
1163 .. 1163 G/C rs3739845 + CDS Synonymous[Ser372Ser]
1183 .. 1183 G/A/C rs10988231 + 3'UTR
1195 .. 1195 G/A rs199585719 + 3'UTR
1207 .. 1207 C/T rs41276758 + 3'UTR
1439 .. 1439 C/T rs11789753 + 3'UTR
1459 .. 1459 C/T rs185391327 + 3'UTR
1519 .. 1519 T/G rs746489 - 3'UTR
1584 .. 1584 C/A rs189753729 + 3'UTR
1653 .. 1653 C/G rs913273 + 3'UTR
1677 .. 1677 C/T rs117313976 + 3'UTR
1792 .. 1792 C/G rs17459361 + 3'UTR
1800 .. 1800 C/T rs12958 + 3'UTR
1840 .. 1840 T/C rs913274 + 3'UTR
1883 .. 1883 A/G rs17459368 + 3'UTR
1908 .. 1908 C/G rs3192345 + 3'UTR
1910 .. 1910 C/G rs151102963 + 3'UTR
2069 .. 2069 C/T rs116280060 + 3'UTR
2070 .. 2070 A/G rs913275 + 3'UTR
2079 .. 2079 T/C rs11554660 + 3'UTR
2112 .. 2112 G/A rs187848226 + 3'UTR
2163 .. 2163 G/A rs141018967 + 3'UTR
2187 .. 2187 C/T rs145141870 + 3'UTR
2189 .. 2189 C/T rs17433499 + 3'UTR
2231 .. 2231 T/A rs4713 + 3'UTR
2245 .. 2245 G/A rs13813 + 3'UTR
2305 .. 2305 C/T rs192072748 + 3'UTR
2307 .. 2307 G/A rs183440860 + 3'UTR
2310 .. 2310 G/A rs141983339 + 3'UTR
2348 .. 2348 C/A rs1052109 + 3'UTR
2354 .. 2354 C/T rs1052125 + 3'UTR
2355 .. 2355 G/A rs17486583 + 3'UTR
2359 .. 2359 C/G rs3207648 + 3'UTR
2365 .. 2365 C/G rs3207652 + 3'UTR
2369 .. 2369 C/G rs3207654 + 3'UTR
2374 .. 2374 C/T rs3207656 + 3'UTR
2376 .. 2376 C/T rs3207657 + 3'UTR
2416 .. 2416 G/T rs3207710 + 3'UTR
2473 .. 2473 C/T rs1052295 + 3'UTR
2477 .. 2477 G/A rs17433513 + 3'UTR
2480 .. 2480 G/A rs1052304 + 3'UTR
2518 .. 2518 C/T rs1052461 + 3'UTR
2525 .. 2525 G/A rs1052475 + 3'UTR
2561 .. 2561 C/G rs1111065 + 3'UTR
2617 .. 2617 C/A rs112423935 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer