H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000030980 Accession number: BC002545 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Serine/threonine-protein phosphatase 2A activator isoform b.
 
 

Motif information
ORF

length(373),orf(48:1169)
MSSKLLEPAGAHLSSGSSEPLVEPGRGRVGARVKGERGLQASGSAPGRSK
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIG
FILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRF
GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRID
YGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYR
MEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKD
YMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL
EKFPVIQHFKFGSLLPIHPVTSG*
a.a.
length
InterPro Name
length(325), motif(49:373) 325 IPR004327 Phosphotyrosyl phosphatase activator, PTPA [Family]
length(295), motif(76:370) 295 IPR004327 Phosphotyrosyl phosphatase activator, PTPA [Family]