H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000031553 Accession number: BC003410 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: NTF2-related export protein 1; Protein p15;
 
 

Transcript original information
Accession number BC003410.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:4978 IMAGE:3450767
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (NXT1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (NXT1);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1176[bp] (No. of exon:2)[A:294 T:257 G:316 C:309]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Placenta, choriocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1118(+) Signal: 1096-1100(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0015690
Genomic location  G-integra Help Chromosome 20
Location 20p11.21
Position 23331373- 23335408
Strand +
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:29107
KEGG GENES KEGG GENES(29107)
GeneCard GeneCardNXT1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000034948
Predicted CDS 388..810;  140[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.81
Database links RefSeq NP_037380
UniProt Q9UKK6
CCDS CCDS13150

Motif information
ORF

length(140),orf(388:810)
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGN
AVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVK
FEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS*
a.a.
length
InterPro Name
length(120), motif(16:135) 120 IPR018222 Nuclear transport factor 2, eukaryote [Domain]
length(119), motif(17:135) 119 IPR002075 Nuclear transport factor 2 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000031553
H-Inv cluster ID Locus viewHIX0015690
Accession number BC003410.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition NTF2-related export protein 1; Protein p15;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q9UKK6)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 10567585108485831125960211583626117800521548933419165146ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NXT1
HGNC aliases "NTX2-like export factor1", "NTF2-like export factor 1"
HGNC name nuclear transport factor 2-like export factor 1
DDBJ NXT1
UniProt NXT1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000034948
No. of interaction 9
Interaction partner(s) HIP000031815HIP000033751HIP000039542HIP000039637HIP000063375HIP000087211HIP000101437HIP000115316HIP000361677
BIND 98981;  98982; 
DIP 115968E; 
MINT MINT-25019;  MINT-67669;  MINT-68466;  MINT-7040261; 
HPRD 02260;  02261;  03109;  03975;  04035;  04116;  09168; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:29107
KEGG GENES KEGG GENES(29107)
GeneCard GeneCardNXT1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Biological process transport (GO:0006810); 
Cellular component intracellular (GO:0005622); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol;  extracellular; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
2 140 1jkgA 1e-36 100.0 139/139 d.17.4.2
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsC051223; 
Affymetrix
GeneChip
HG-Focus 218708_at; 
HG-U133 218708_at; 
HG-U133A 218708_at; 
HG-U133A_2 218708_at; 
HG-U133B NA
HG-U133_Plus_2 218708_at; 
HG-U95 48836_s_at;  64041_at; 
HG-U95A NA
HG-U95B 48836_s_at; 
HG-U95C 64041_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3510429;  3510430;  3510431;  3510433;  3880177;  3880178;  3880179;  3880180;  3880181;  3880184;  3880185;  3880186;  3880187;  3880188;  3901167; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P251695; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P251695; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Bos sp. (Cow) BC112489 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC122134 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR706647 G-integraG-integra
Orthology Mus sp. (Mouse) ENSMUST00000109961 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000012504 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000135058 G-integraG-integra
Orthology Rattus sp. (Rat) XM_001057228 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_001146149 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001372109 G-integraG-integra
Orthology Canis sp. (Dog) XM_534323 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
57 .. 57 C/A rs142868260 + 5'UTR
77 .. 77 G/C rs151073152 + 5'UTR
242 .. 242 C/G rs189848672 + 5'UTR
367 .. 367 C/T rs202108278 + 5'UTR
444 .. 444 G/A rs34105430 - CDS Synonymous[Glu19Glu]
452 .. 452 A/G rs149042553 + CDS Nonsynonymous[Asn22Ser]
462 .. 462 C/T rs142050922 + CDS Synonymous[Tyr25Tyr]
490 .. 490 C/T rs41282288 + CDS Synonymous[Leu35Leu]
492 .. 492 G/C rs201558944 + CDS Synonymous[Leu35Leu]
505 .. 505 A/G rs140297530 + CDS Nonsynonymous[Met40Val]
605 .. 605 G/A rs145307350 + CDS Nonsynonymous[Ser73Asn]
723 .. 723 C/A rs6114063 + CDS Nonsynonymous[Asn112Lys]
735 .. 735 C/G rs143714669 + CDS Synonymous[Thr116Thr]
831 .. 831 T/C rs201704168 + 3'UTR
840 .. 840 T/C rs113253216 + 3'UTR
954 .. 954 C/T rs1046125 + 3'UTR
961 .. 961 G/T rs1046128 + 3'UTR
1008 .. 1008 C/T rs2683 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer