H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000031553 Accession number: BC003410 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: NTF2-related export protein 1; Protein p15;
 
 

Motif information
ORF

length(140),orf(388:810)
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGN
AVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVK
FEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS*
a.a.
length
InterPro Name
length(120), motif(16:135) 120 IPR018222 Nuclear transport factor 2, eukaryote [Domain]
length(119), motif(17:135) 119 IPR002075 Nuclear transport factor 2 [Domain]