H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000031605 Accession number: BC003567 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Epoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
 
 

Transcript original information
Accession number BC003567.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:2074 IMAGE:3547085
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (EPHX1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (EPHX1);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1623[bp] (No. of exon:8)[A:368 T:360 G:409 C:486]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Skin, melanotic melanoma.
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1606(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0199950
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 226016426- 226033261
Strand +
Possible duplicated location(s) NA
Gene structure 8 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2052
KEGG GENES KEGG GENES(2052)
GeneCard GeneCardEPHX1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000114879
Predicted CDS 26..1393;  455[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.841
Database links RefSeq NP_000111NP_001129490
UniProt P07099
CCDS CCDS1547

Motif information
ORF

length(455),orf(26:1393)
MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRP
FKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNE
FDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGW
PGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFN
SVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNM
ALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM
HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSA
FPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLS
VLERQ*
a.a.
length
InterPro Name
length(419), motif(33:451) 419 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(408), motif(42:449) 408 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(113), motif(49:161) 113 IPR010497 Epoxide hydrolase, N-terminal [Domain]
length(19), motif(148:166) 19 IPR000639 Epoxide hydrolase-like [Family]
length(16), motif(177:192) 16 IPR000639 Epoxide hydrolase-like [Family]
length(217), motif(178:394) 217 IPR000073 Alpha/beta hydrolase fold-1 [Domain]
length(14), motif(222:235) 14 IPR000639 Epoxide hydrolase-like [Family]
length(14), motif(236:249) 14 IPR000639 Epoxide hydrolase-like [Family]
length(17), motif(394:410) 17 IPR000639 Epoxide hydrolase-like [Family]
length(23), motif(426:448) 23 IPR000639 Epoxide hydrolase-like [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000031605
H-Inv cluster ID Locus viewHIX0199950
Accession number BC003567.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Epoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P07099)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 28917133502697751677678358931105892112173035128783211548933415535985156187301671041421269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol EPHX1
HGNC aliases NA
HGNC name epoxide hydrolase 1, microsomal (xenobiotic)
DDBJ EPHX1
UniProt EPHX1
EC number EC 3.3.2.9microsomal epoxide hydrolase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00980 :Metabolism of xenobiotics by cytochrome P450; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000114879
No. of interaction 1
Interaction partner(s) HIP000135231
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2052
KEGG GENES KEGG GENES(2052)
GeneCard GeneCardEPHX1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR259384
Accession
Description
Location
PMID

Gene ontology information
Molecular function catalytic activity (GO:0003824); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT endoplasmic;  extracellular;  golgi apparatus;  peroxisome;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
42 449 1qo7A 4e-32 26.0 369/385 c.69.1.11
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA250218; 
Affymetrix
GeneChip
HG-Focus 202017_at; 
HG-U133 202017_at; 
HG-U133A 202017_at; 
HG-U133A_2 202017_at; 
HG-U133B NA
HG-U133_Plus_2 202017_at; 
HG-U95 38790_at;  59694_at; 
HG-U95A 38790_at; 
HG-U95B NA
HG-U95C 59694_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2382976;  2382979;  2382986;  2382987;  2382988;  2382993;  2382996;  2382997;  2382998;  2458516; 
HuGeneFL L25878_s_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P34537; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P34537; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Hypercholanemia, familial (607748);  Disease name: {Preeclampsia, susceptibility to} (189800); 
Related information in OMIM OMIM ID:  132810;  Title: EPOXIDE HYDROLASE 1, MICROSOMAL
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(2052)
Disease Entrez Gene ID:(2052)
Substance Entrez Gene ID:(2052)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
55 .. 55 G/A rs200493338 + CDS Synonymous[Val10Val]
61 .. 61 C/T rs148398736 + CDS Synonymous[Gly12Gly]
102 .. 102 C/G rs200146699 + CDS Nonsynonymous[Thr26Ser]
146 .. 146 G/A rs11540967 + CDS Nonsynonymous[Ala41Thr]
153 .. 153 G/C rs3738046 + CDS Nonsynonymous[Arg43Thr]
170 .. 170 C/T rs2234697 + CDS Nonsynonymous[Arg49Cys]
190 .. 190 G/A rs182154631 + CDS Synonymous[Thr55Thr]
200 .. 200 G/T rs11540969 + CDS AA-STOP[Glu59*]
215 .. 215 C/A rs146362595 + CDS Nonsynonymous[His64Asn]
229 .. 229 T/C rs2234698 + CDS Synonymous[Asp68Asp]
236 .. 236 C/T rs148240980 + CDS Nonsynonymous[Arg71Cys]
237 .. 237 G/A rs58623835 + CDS Nonsynonymous[Arg71His]
256 .. 256 G/A rs55798709 + CDS Synonymous[Glu77Glu]
271 .. 271 C/G rs145942697 + CDS Nonsynonymous[His82Gln]
289 .. 289 C/T rs139835798 + CDS Synonymous[Asn88Asn]
315 .. 315 G/A rs4986931 + CDS AA-STOP[Trp97*]
328 .. 328 T/C rs2234699 + CDS Synonymous[Phe101Phe]
344 .. 344 G/C rs200804772 + CDS Nonsynonymous[Val107Leu]
360 .. 360 G/A rs145813024 + CDS Nonsynonymous[Arg112Lys]
362 .. 362 T/C rs1051740 + CDS Nonsynonymous[Tyr113His]
375 .. 375 A/G rs67892231 + CDS Nonsynonymous[Lys117Arg]
382 .. 382 G/A rs1131873 + CDS Synonymous[Lys119Lys]
382 .. 382 G/A rs2292566 + CDS Synonymous[Lys119Lys]
408 .. 408 T/C rs138091095 + CDS Nonsynonymous[Ile128Thr]
412 .. 412 C/A/T rs112721617 + CDS
434 .. 434 G/A rs141157588 + CDS Nonsynonymous[Ala137Thr]
440 .. 440 C/T rs55784606 + CDS Nonsynonymous[His139Tyr]
441 .. 441 A/G rs2234922 + CDS Nonsynonymous[His139Arg]
478 .. 478 C/T rs147296174 + CDS Synonymous[Pro151Pro]
481 .. 481 C/T rs144904318 + CDS Synonymous[Gly152Gly]
490 .. 490 C/T rs199979074 + CDS Synonymous[Tyr155Tyr]
519 .. 519 C/T rs139835141 + CDS Nonsynonymous[Thr165Ile]
548 .. 548 G/A rs151050888 + CDS Nonsynonymous[Glu175Lys]
608 .. 608 T/C rs140788022 + CDS Nonsynonymous[Ser195Pro]
662 .. 662 C/T rs112886664 + CDS Synonymous[Leu213Leu]
711 .. 711 C/T rs138769642 + CDS Nonsynonymous[Ser229Phe]
729 .. 729 T/C rs148810909 + CDS Nonsynonymous[Met235Thr]
755 ^ 756 -/A rs66903687 + CDS
756 .. 756 A/G rs141680636 + CDS Nonsynonymous[Lys244Arg]
766 .. 766 C/T rs34143170 + CDS Synonymous[His247His]
767 ^ 768 -/TT rs56132313 + CDS
787 .. 787 A/G rs35561387 + CDS Synonymous[Leu254Leu]
793 .. 793 C/A rs56300109 + CDS Nonsynonymous[Asn256Lys]
797 .. 797 T/G rs148730399 + CDS Nonsynonymous[Ser258Ala]
803 .. 803 C/T rs35967527 + CDS Synonymous[Leu260Leu]
808 .. 808 C/T rs146743027 + CDS Synonymous[Thr261Thr]
848 .. 848 A/G rs35073925 + CDS Nonsynonymous[Thr275Ala]
877 .. 877 C/T rs2292568 + CDS Synonymous[Pro284Pro]
878 .. 878 G/C rs45449793 + CDS Nonsynonymous[Val285Leu]
895 .. 895 C/T rs1803538 + CDS Synonymous[Phe290Phe]
953 .. 953 G/A rs143164964 + CDS Nonsynonymous[Val310Ile]
1081 .. 1081 C/T rs140207745 + CDS Synonymous[Asp352Asp]
1096 .. 1096 C/T rs1051741 + CDS Synonymous[Asn357Asn]
1146 .. 1146 A/C rs72549341 + CDS Nonsynonymous[Tyr374Ser]
1186 .. 1186 T/A rs2137841 - CDS Nonsynonymous[His387Gln]
1189 .. 1189 G/A rs150700932 + CDS Synonymous[Glu388Glu]
1241 .. 1241 T/C rs2234700 + CDS Synonymous[Leu406Leu]
1248 .. 1248 C/T rs45495897 + CDS Nonsynonymous[Thr408Met]
1264 .. 1264 G/A rs45540739 + CDS Synonymous[Val413Val]
1267 .. 1267 G/A rs142674326 + CDS Synonymous[Arg414Arg]
1273 .. 1273 G/A rs4149229 + CDS Synonymous[Lys416Lys]
1307 .. 1307 C/T rs199757500 + CDS Nonsynonymous[Arg428Cys]
1308 .. 1308 G/A rs141221713 + CDS Nonsynonymous[Arg428His]
1324 .. 1324 G/A rs45550332 + CDS Synonymous[Ala433Ala]
1339 .. 1339 G/A rs45464298 + CDS Synonymous[Pro438Pro]
1366 .. 1366 G/A rs202036186 + CDS Synonymous[Lys447Lys]
1375 .. 1375 G/C rs4149230 + CDS Synonymous[Ser450Ser]
1380 .. 1380 T/A rs45563137 + CDS Nonsynonymous[Leu452Gln]
1386 .. 1386 G/A rs2234701 + CDS Nonsynonymous[Arg454Gln]
1408 .. 1408 C/G rs200292137 + 3'UTR
1427 .. 1427 C/T rs201119273 + 3'UTR
1428 .. 1428 A/C rs4653695 + 3'UTR
1490 .. 1490 C/T rs191971826 + 3'UTR
1518 .. 1518 C/T rs71646751 + 3'UTR
1527 .. 1528 TC/CA rs71574541 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer