H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000031962 Accession number: BC004458 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Transcript original information
Accession number BC004458.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:4315 IMAGE:2820106
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ENO1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ENO1);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1814[bp] (No. of exon:12)[A:454 T:395 G:488 C:477]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lung, small cell carcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1768(+) Signal: 1744-1748(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000101
Genomic location  G-integra Help Chromosome 1
Location 1p36.23
Position 8921064- 8938737
Strand -
Possible duplicated location(s) NA
Gene structure 12 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000099039
Predicted CDS 109..1413;  434[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.806
Database links RefSeq NP_001419
UniProt P06733
CCDS CCDS97

Motif information
ORF

length(434),orf(109:1413)
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR
DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT
ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF
NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY
GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE
FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR
SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK*
a.a.
length
InterPro Name
length(432), motif(1:432) 432 IPR000941 Enolase [Family]
length(124), motif(3:126) 124 IPR029017 Enolase N-terminal domain-like [Domain]
length(136), motif(3:138) 136 IPR029017 Enolase N-terminal domain-like [Domain]
length(132), motif(3:134) 132 IPR020811 Enolase, N-terminal [Domain]
length(427), motif(3:429) 427 IPR000941 Enolase [Family]
length(15), motif(35:49) 15 IPR000941 Enolase [Family]
length(17), motif(107:123) 17 IPR000941 Enolase [Family]
length(304), motif(128:431) 304 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(164:177) 14 IPR000941 Enolase [Family]
length(12), motif(317:328) 12 IPR000941 Enolase [Family]
length(14), motif(340:353) 14 IPR020809 Enolase, conserved site [Conserved_site]
length(15), motif(340:354) 15 IPR000941 Enolase [Family]
length(18), motif(369:386) 18 IPR000941 Enolase [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000031962
H-Inv cluster ID Locus viewHIX0000101
Accession number BC004458.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P06733)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 13692092005901237308135290907787969882471691101749150948930876096536459878089100825541068158910802057111343511149723912297304126661331470203915489334155924551613979816548883167104141681597517974005186696481960886119690332200682312126946021908771ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ENO1
HGNC aliases NA
HGNC name enolase 1, (alpha)
DDBJ ENO1
UniProt ENO1
EC number EC 4.2.1.11phosphopyruvate hydratase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00010 :Glycolysis / Gluconeogenesis;  00400 :Phenylalanine, tyrosine and tryptophan biosynthesis; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000099039
No. of interaction 5
Interaction partner(s) HIP000034294HIP000082842HIP000091335HIP000120293HIP000136154
BIND 145679; 
DIP 133943E;  180033E; 
MINT MINT-2858506;  MINT-3304712;  MINT-49071;  MINT-49243;  MINT-51023;  MINT-7995173;  MINT-7995182;  MINT-7995334; 
HPRD 00010;  00017;  00032;  01417;  01456;  03183;  03229;  03387;  03465;  04078;  04585;  05496;  07601;  08442;  09113;  10584;  14358;  16050;  16246; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function phosphopyruvate hydratase activity (GO:0004634);  magnesium ion binding (GO:0000287); 
Biological process glycolysis (GO:0006096); 
Cellular component phosphopyruvate hydratase complex (GO:0000015); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
3 139 1e9iA2 2e-59 63.7 135/139 d.54.1.1
141 431 1e9iA1 3e-81 48.4 285/291 c.1.11.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus 201231_s_at; 
HG-U133 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133B NA
HG-U133_Plus_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U95 2035_s_at; 
HG-U95A 2035_s_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2319118;  2395498;  2395499;  2395503;  2395504;  2395505;  2395507;  2395510;  2395518; 
HuGeneFL M14328_s_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P105501;  A_32_P229365; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name:NA
Related information in OMIM OMIM ID:  172430;  Title: ENOLASE 1
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(2023)
Disease Entrez Gene ID:(2023)
Substance Entrez Gene ID:(2023)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
28 .. 28 C/T rs17032795 + 5'UTR
64 .. 64 C/T rs11544506 + 5'UTR
70 .. 70 C/T rs11544510 + 5'UTR
152 .. 152 G/T rs11544495 + CDS Nonsynonymous[Arg15Leu]
233 .. 233 G/C rs11544503 + CDS Nonsynonymous[Gly42Ala]
239 .. 239 A/G rs138834005 - CDS Nonsynonymous[Tyr44Cys]
275 .. 275 G/A rs201990176 - CDS Nonsynonymous[Arg56His]
283 .. 283 G/A rs142310173 - CDS Nonsynonymous[Gly59Arg]
309 .. 309 G/A rs28999074 + CDS Synonymous[Glu67Glu]
312 .. 312 C/T rs201513751 - CDS Synonymous[His68His]
317 .. 317 A/G rs201867667 - CDS Nonsynonymous[Asn70Ser]
331 .. 331 C/A rs146938354 - CDS Nonsynonymous[Pro75Thr]
339 .. 339 G/A rs28999075 + CDS Synonymous[Leu77Leu]
340 .. 340 G/T rs146619828 - CDS Nonsynonymous[Val78Phe]
390 .. 390 G/C rs11544491 + CDS Nonsynonymous[Met94Ile]
401 .. 401 A/G rs201943492 - CDS Nonsynonymous[Asp98Gly]
432 .. 432 G/A rs200935067 - CDS Synonymous[Ala108Ala]
460 .. 460 G/A rs199529530 - CDS Nonsynonymous[Val118Ile]
465 .. 465 C/T rs11544507 + CDS Synonymous[Cys119Cys]
478 .. 478 G/A/C rs11544519 + CDS
504 ^ 505 -/CC rs144538182 - CDS
507 .. 507 C/T rs11544497 + CDS Synonymous[His133His]
525 .. 525 C/A rs142256351 - CDS Synonymous[Gly139Gly]
603 .. 603 G/C rs11544509 + CDS Nonsynonymous[Met165Ile]
639 .. 639 C/A/T rs11544513 + CDS
675 .. 675 C/T rs11544499 + CDS Synonymous[Tyr189Tyr]
677 .. 677 A/G rs201627070 - CDS Nonsynonymous[His190Arg]
694 .. 694 A/G rs199771237 - CDS Nonsynonymous[Ile196Val]
742 .. 742 G/A rs201238976 - CDS Nonsynonymous[Gly212Arg]
818 .. 818 C/T rs148752848 - CDS Nonsynonymous[Thr237Ile]
832 .. 832 A/G rs138820314 - CDS Nonsynonymous[Ile242Val]
835 .. 835 G/A rs143707545 - CDS Nonsynonymous[Gly243Ser]
843 .. 843 C/G/T rs2230874 + CDS
848 .. 848 C/T rs201508705 - CDS Nonsynonymous[Ala247Val]
855 .. 855 C/T rs143076849 - CDS Synonymous[Ser249Ser]
856 .. 856 G/C/T rs11544512 + CDS
1005 .. 1005 T/C rs140944386 - CDS Synonymous[Asp299Asp]
1082 .. 1082 C/A rs11544514 + CDS Nonsynonymous[Pro325Gln]
1083 .. 1083 A/C rs140674283 - CDS Synonymous[Pro325Pro]
1095 .. 1095 C/A rs3180139 + CDS Synonymous[Ala329Ala]
1107 .. 1107 C/T rs146867004 - CDS Synonymous[Asn333Asn]
1172 .. 1172 A/C rs201636531 - CDS Nonsynonymous[Gln355Pro]
1178 .. 1178 G/A rs200008125 - CDS Nonsynonymous[Cys357Tyr]
1196 .. 1196 A/G rs151047591 - CDS Nonsynonymous[Asn363Ser]
1222 .. 1222 C/T rs150781341 - CDS Nonsynonymous[Arg372Cys]
1226 .. 1226 C/T rs143592223 - CDS Nonsynonymous[Ser373Leu]
1231 .. 1231 G/A rs3206672 + CDS Nonsynonymous[Glu375Lys]
1267 .. 1267 G/C rs11544489 + CDS Nonsynonymous[Gly387Arg]
1316 .. 1316 G/A rs201032262 - CDS Nonsynonymous[Arg403His]
1346 .. 1346 T/C rs201317089 - CDS Nonsynonymous[Ile413Thr]
1356 .. 1356 G/A rs193006639 - CDS Synonymous[Glu416Glu]
1401 .. 1401 C/T rs1065722 + CDS Synonymous[Pro431Pro]
1407 .. 1407 C/A rs139671695 - CDS Synonymous[Ala433Ala]
1413 .. 1413 A/G rs138375821 - CDS Synonymous_atSTOP[*435*]
1430 .. 1430 C/G rs1065725 + 3'UTR
1464 .. 1464 C/T rs11544498 + 3'UTR
1468 .. 1468 C/G rs3207089 + 3'UTR
1503 .. 1503 C/A rs3211543 + 3'UTR
1535 .. 1535 A/C rs3206703 + 3'UTR
1537 .. 1537 C/T rs11544504 + 3'UTR
1588 ^ 1589 -/C rs35715680 - 3'UTR
1621 .. 1621 C/T rs3206709 + 3'UTR
1638 .. 1638 T/A rs28999102 + 3'UTR
1657 .. 1657 A/C rs3199777 + 3'UTR
1664 .. 1664 A/C rs1065737 + 3'UTR
1676 .. 1676 G/A rs1059149 + 3'UTR
1696 .. 1696 C/T rs1803537 + 3'UTR
1699 .. 1699 C/T rs1059176 + 3'UTR
1712 .. 1712 A/C rs3206710 + 3'UTR
1765 .. 1765 A/G rs113945549 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer