H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000031962 Accession number: BC004458 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Motif information
ORF

length(434),orf(109:1413)
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR
DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT
ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF
NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY
GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE
FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR
SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK*
a.a.
length
InterPro Name
length(432), motif(1:432) 432 IPR000941 Enolase [Family]
length(124), motif(3:126) 124 IPR029017 Enolase N-terminal domain-like [Domain]
length(136), motif(3:138) 136 IPR029017 Enolase N-terminal domain-like [Domain]
length(132), motif(3:134) 132 IPR020811 Enolase, N-terminal [Domain]
length(427), motif(3:429) 427 IPR000941 Enolase [Family]
length(15), motif(35:49) 15 IPR000941 Enolase [Family]
length(17), motif(107:123) 17 IPR000941 Enolase [Family]
length(304), motif(128:431) 304 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(164:177) 14 IPR000941 Enolase [Family]
length(12), motif(317:328) 12 IPR000941 Enolase [Family]
length(14), motif(340:353) 14 IPR020809 Enolase, conserved site [Conserved_site]
length(15), motif(340:354) 15 IPR000941 Enolase [Family]
length(18), motif(369:386) 18 IPR000941 Enolase [Family]