H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000032262 Accession number: BC005171 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Chaperone activity of bc1 complex-like, mitochondrial; Chaperone-ABC1-like; EC=2.7.11.-; aarF domain-containing protein kinase 3; Precursor;
 
 

Transcript original information
Accession number BC005171.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:4849 IMAGE:3604948
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ADCK3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ADCK3);
Sequence data provider Provider:MGC/NCI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 2913[bp] (No. of exon:15)[A:655 T:586 G:856 C:816]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Uterus, endometrium adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2872(+) Signal: 2849-2853(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001648
Genomic location  G-integra Help Chromosome 1
Location 1q42.13
Position 227127989- 227175244
Strand +
Possible duplicated location(s) NA
Gene structure 15 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:56997; 
KEGG GENES KEGG GENES(56997); 
GeneCard GeneCardADCK3;  *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000022505
Predicted CDS 122..2065;  647[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.859
Database links RefSeq NP_064632; 
UniProt Q8NI60; 
CCDS CCDS1557; 

Motif information
ORF

length(647),orf(122:2065) MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQ IGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD QSAPPSLGHAHSEGPAPAYVASGPFREAGFPGQASSPLGRANGRLFANPR DSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQTLSEH ARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSEDPSGKKAVLG SSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMK GGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRR ELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSG FPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQ HKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGY EVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLV PPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ* 		a.a.
length		 InterPro Name
length(50), motif(315:364) 50 IPR011009 Protein kinase-like domain [Domain]
length(115), motif(319:433) 115 IPR004147 UbiB domain [Domain]
length(127), motif(396:522) 127 IPR011009 Protein kinase-like domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000032262
H-Inv cluster ID Locus viewHIX0001648
Accession number BC005171.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Chaperone activity of bc1 complex-like, mitochondrial; Chaperone-ABC1-like; EC=2.7.11.-; aarF domain-containing protein kinase 3; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q8NI60)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 11888884;  14702039;  15489334;  15498874;  16710414;  17344846;  17974005;  18319072;  18319074;  21269460;  ALL; 
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ADCK3
HGNC aliases "chaperone-ABC1 (activity of bc1 complex, S.pombe)-like", "chaperone, ABC1 activity of bc1 complex like (S. pombe)", "chaperone, ABC1 activity of bc1 complex homolog (S. pombe)"
HGNC name aarF domain containing kinase 3
DDBJ CABC1
UniProt ADCK3
EC number EC 2.7.11.-Protein-serine/threonine kinases; 
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000022505
No. of interaction 23
Interaction partner(s) HIP000021385;  HIP000023960;  HIP000026585;  HIP000026585;  HIP000036366;  HIP000048821;  HIP000053966;  HIP000054822;  HIP000058896;  HIP000059460;  HIP000074321;  HIP000075289;  HIP000076337;  HIP000084466;  HIP000096767;  HIP000097392;  HIP000100543;  HIP000114585;  HIP000116926;  HIP000138121;  HIP000249412;  HIP000335321;  HIP000435860; 
BIND NA
DIP 116837E; 
MINT MINT-66678;  MINT-8079030; 
HPRD 02202;  05375; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:56997; 
KEGG GENES KEGG GENES(56997); 
GeneCard GeneCardADCK3;  *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR306988
Accession
Description
Location
PMID

Gene ontology information
Molecular function transferase activity, transferring phosphorus-containing groups (GO:0016772); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT mitochondria;  cytosol;  peroxisome;  Other; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
267 323 1y74A1 7e-22 17.5 57/57 a.194.1.1
315 597 1zylA1 3e-14 10.5 277/325 d.144.1.6
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator		 AceGene AGhsA241008; 
Affymetrix
GeneChip		 HG-Focus NA
HG-U133 218168_s_at;  222542_x_at; 
HG-U133A 218168_s_at; 
HG-U133A_2 218168_s_at; 
HG-U133B 222542_x_at; 
HG-U133_Plus_2 218168_s_at;  222542_x_at; 
HG-U95 45334_at;  64312_at; 
HG-U95A NA
HG-U95B 45334_at; 
HG-U95C 64312_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2383379;  2383389;  2383390;  2383391;  2383392;  2383393;  2383394;  2383395;  2383396;  2383404;  2383407;  2383409;  2383411;  2383413;  2383416;  2383419;  2383420;  2383421;  2383422;  2383424;  2383425;  2459040; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P85593; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P85598; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator; 

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) AK014605 MGI:1896736 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC076083 G-integraG-integra
Orthology Rattus sp. (Rat) BC091388 G-integraG-integra
Orthology Bos sp. (Cow) BC114164 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000021587 G-integraG-integra
Orthology Macaca sp. (Macaque) ENSMMUT00000012079 G-integraG-integra
Orthology Monodelphis sp. (Opossum) ENSMODT00000036703 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000021446 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000000170 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00035765001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000143815 G-integraG-integra
Orthology Gallus sp. (Chicken) XM_415040 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_514248 G-integraG-integra
Orthology Canis sp. (Dog) XM_537230 G-integraG-integra
Orthology Danio sp. (Zebrafish) XM_693745 G-integraG-integra
Phylogenetic tree [View by ATV]
 Neighbor-joining (phb) 
Related H-InvDB links EvolaEvola;  dN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
122 .. 122 A/G rs199604256 + CDS Nonsynonymous[Met1Val]
132 .. 132 T/A rs202075418 + CDS Nonsynonymous[Ile4Lys]
156 .. 156 C/T rs200052870 + CDS Nonsynonymous[Ala12Val]
171 .. 171 A/G rs150221608 + CDS Nonsynonymous[Lys17Arg]
183 .. 183 C/T rs142184584 + CDS Nonsynonymous[Ala21Val]
184 .. 184 G/A rs11549709 + CDS Synonymous[Ala21Ala]
188 .. 188 G/A rs35582308 + CDS Nonsynonymous[Val23Met]
199 .. 199 C/T rs150541057 + CDS Synonymous[His26His]
217 .. 217 C/T rs199919057 + CDS Synonymous[Ile32Ile]
221 .. 221 G/A rs142125927 + CDS Nonsynonymous[Gly34Arg]
238 .. 238 G/A rs11549708 + CDS Synonymous[Ala39Ala]
258 .. 258 C/T rs187123516 + CDS Nonsynonymous[Thr46Met]
292 .. 292 G/C rs200123840 + CDS Nonsynonymous[Lys57Asn]
352 .. 352 G/A rs201037948 + CDS Synonymous[Gly77Gly]
359 .. 359 C/T rs76249490 + CDS Nonsynonymous[His80Tyr]
361 .. 361 C/T rs113667144 + CDS Synonymous[His80His]
362 .. 362 T/C rs200349511 + CDS Nonsynonymous[Phe81Leu]
376 .. 376 T/G rs2297411 + CDS Nonsynonymous[His85Gln]
378 .. 378 C/T rs150377969 + CDS Nonsynonymous[Ala86Val]
379 .. 379 A/C rs137872711 + CDS Synonymous[Ala86Ala]
380 .. 380 G/A rs138572539 + CDS Nonsynonymous[Ala87Thr]
384 .. 384 G/T rs141687205 + CDS Nonsynonymous[Gly88Val]
412 .. 412 C/T rs111529228 + CDS Synonymous[Ser97Ser]
413 .. 413 G/T rs200000374 + CDS Nonsynonymous[Ala98Ser]
419 .. 419 G/T rs150696959 + CDS Nonsynonymous[Asp100Tyr]
446 .. 446 C/G rs201479287 + CDS Nonsynonymous[His109Asp]
456 .. 456 G/A rs147889685 + CDS Nonsynonymous[Ser112Asn]
505 .. 505 C/T rs139970507 + CDS Synonymous[Ala128Ala]
523 .. 523 C/T rs200182503 + CDS Synonymous[Ala134Ala]
588 .. 588 T/C rs147812454 + CDS Nonsynonymous[Met156Thr]
593 .. 593 T/C rs142652509 + CDS Nonsynonymous[Phe158Leu]
642 .. 642 C/A rs181579601 + CDS Nonsynonymous[Thr174Lys]
646 .. 646 C/T rs201787750 + CDS Synonymous[Ala175Ala]
685 .. 685 C/T rs140897240 + CDS Synonymous[Pro188Pro]
708 .. 708 C/T rs200762439 + CDS Nonsynonymous[Thr196Met]
715 .. 715 C/T rs138547552 + CDS Synonymous[Ser198Ser]
722 .. 722 G/T rs188599627 + CDS Nonsynonymous[Ala201Ser]
726 .. 726 G/A rs145350362 + CDS Nonsynonymous[Arg202Gln]
732 .. 732 G/A rs200541514 + CDS Nonsynonymous[Arg204Gln]
739 .. 739 G/A rs115855910 + CDS Synonymous[Val206Val]
758 .. 758 C/T rs119468005 + CDS Nonsynonymous[Arg213Trp]
800 .. 800 G/A rs199694417 + CDS Nonsynonymous[Gly227Arg]
844 .. 844 C/- rs35757883 + CDS
851 .. 851 G/C rs199619932 + CDS Nonsynonymous[Gly244Arg]
863 .. 863 G/A rs148376283 + CDS Nonsynonymous[Val248Met]
866 .. 866 C/T rs199958142 + CDS Synonymous[Leu249Leu]
901 .. 901 A/G rs147447166 + CDS Synonymous[Ala260Ala]
906 .. 906 G/A rs145422777 + CDS Nonsynonymous[Arg262Gln]
915 .. 915 G/A rs199696414 + CDS Nonsynonymous[Arg265His]
918 .. 918 C/T rs149924675 + CDS Nonsynonymous[Thr266Met]
932 .. 932 C/T rs145034527 + CDS Nonsynonymous[Arg271Cys]
936 .. 936 G/A/T rs119468006 + CDS
975 .. 975 A/C rs143493998 + CDS Nonsynonymous[Asp285Ala]
994 .. 994 C/T rs200849486 + CDS Synonymous[Pro291Pro]
997 .. 997 C/G rs200155917 + CDS Nonsynonymous[His292Gln]
1012 .. 1012 C/T rs55968053 + CDS Synonymous[Phe297Phe]
1016 .. 1016 C/T rs201908721 + CDS Nonsynonymous[Arg299Trp]
1022 .. 1022 C/T rs140246430 + CDS Nonsynonymous[Arg301Trp]
1030 .. 1030 C/T rs202036077 + CDS Synonymous[Ser303Ser]
1069 .. 1069 C/T rs55637780 + CDS Synonymous[Leu316Leu]
1110 .. 1110 A/G rs150243147 + CDS Nonsynonymous[Tyr330Cys]
1112 .. 1112 T/C rs201334858 + CDS Nonsynonymous[Phe331Leu]
1114 .. 1114 C/T rs41303129 + CDS Synonymous[Phe331Phe]
1130 .. 1130 G/A rs143816043 + CDS Nonsynonymous[Ala337Thr]
1132 .. 1132 C/T rs36006006 + CDS Synonymous[Ala337Ala]
1141 .. 1141 C/T rs181558991 + CDS Synonymous[Ser340Ser]
1143 .. 1143 T/C rs55798516 + CDS Nonsynonymous[Ile341Thr]
1174 .. 1174 C/T rs55958233 + CDS Synonymous[Gly351Gly]
1210 .. 1210 C/T rs139570869 + CDS Synonymous[Gly363Gly]
1229 .. 1229 A/G rs180784380 + CDS Nonsynonymous[Ser370Gly]
1241 .. 1241 A/C rs146751657 + CDS Nonsynonymous[Asn374His]
1306 .. 1306 T/C rs17849927 + CDS Synonymous[Ile395Ile]
1309 .. 1309 C/T rs139133094 + CDS Synonymous[Asp396Asp]
1314 .. 1314 T/C rs199921339 + CDS Nonsynonymous[Leu398Pro]
1336 .. 1336 G/A rs149048093 + CDS Synonymous[Glu405Glu]
1367 .. 1367 C/T rs151292389 + CDS Nonsynonymous[Arg416Cys]
1372 .. 1372 G/A rs202227926 + CDS Synonymous[Lys417Lys]
1379 .. 1379 G/A rs147097934 + CDS Nonsynonymous[Asp420Asn]
1385 .. 1385 C/T rs200375779 + CDS Synonymous[Leu422Leu]
1407 .. 1407 A/G rs144147839 + CDS Nonsynonymous[Tyr429Cys]
1453 .. 1453 C/T rs138727410 + CDS Synonymous[Thr444Thr]
1499 .. 1499 A/G rs149364914 + CDS Nonsynonymous[Ser460Gly]
1511 .. 1511 C/T rs139900636 + CDS Nonsynonymous[Arg464Trp]
1517 .. 1517 G/A rs201134290 + CDS Nonsynonymous[Glu466Lys]
1530 .. 1530 A/G rs200800365 + CDS Nonsynonymous[Asn470Ser]
1543 .. 1543 G/A rs202132812 + CDS Synonymous[Leu474Leu]
1551 .. 1551 G/- rs34158214 + CDS
1561 .. 1561 C/T rs12593 - CDS Synonymous[Phe480Phe]
1600 .. 1600 C/A rs150918577 + CDS Nonsynonymous[Asn493Lys]
1654 .. 1654 G/A rs201337210 + CDS Synonymous[Thr511Thr]
1655 .. 1655 C/T rs149682899 + CDS Nonsynonymous[Arg512Trp]
1656 .. 1656 G/A rs200115323 + CDS Nonsynonymous[Arg512Gln]
1662 .. 1662 A/G rs119468008 + CDS Nonsynonymous[Tyr514Cys]
1677 .. 1677 C/G rs141260985 + CDS Nonsynonymous[Thr519Ser]
1688 .. 1688 A/G rs147730489 + CDS Nonsynonymous[Ile523Val]
1712 .. 1712 G/A rs200930703 + CDS Nonsynonymous[Asp531Asn]
1726 .. 1726 G/C rs201158713 + CDS Nonsynonymous[Glu535Asp]
1727 .. 1727 A/G rs200403220 + CDS Nonsynonymous[Thr536Ala]
1731 .. 1731 T/G rs199724504 + CDS Nonsynonymous[Val537Gly]
1733 .. 1733 C/T rs201331131 + CDS Nonsynonymous[Arg538Trp]
1738 .. 1738 G/A rs142600066 + CDS Synonymous[Ala539Ala]
1765 .. 1765 C/T rs141423403 + CDS Synonymous[Thr548Thr]
1766 .. 1766 G/A rs119468009 + CDS Nonsynonymous[Gly549Ser]
1772 .. 1772 G/A rs119468004 + CDS Nonsynonymous[Glu551Lys]
1786 .. 1786 G/A rs199874519 + CDS Nonsynonymous[Met555Ile]
1793 .. 1793 G/A rs142894121 + CDS Nonsynonymous[Ala558Thr]
1798 .. 1798 C/G rs200963031 + CDS Nonsynonymous[His559Gln]
1831 .. 1831 C/T rs139305619 + CDS Synonymous[Phe570Phe]
1837 .. 1837 T/C rs3738725 + CDS Synonymous[Ser572Ser]
1841 .. 1841 G/A rs202058665 + CDS Nonsynonymous[Glu574Lys]
1860 .. 1860 C/T rs199581236 + CDS Nonsynonymous[Thr580Ile]
1873 .. 1873 C/T rs201865243 + CDS Synonymous[Thr584Thr]
1876 .. 1876 G/C rs201171077 + CDS Nonsynonymous[Glu585Asp]
1878 .. 1878 A/G rs113308613 + CDS Nonsynonymous[Lys586Arg]
1886 .. 1886 A/C rs142051104 + CDS Nonsynonymous[Asn589His]
1897 .. 1897 C/T rs7545723 + CDS Synonymous[Pro592Pro]
1918 .. 1918 C/T rs139551241 + CDS Synonymous[Leu599Leu]
1921 .. 1921 C/G rs74589348 + CDS Synonymous[Val600Val]
1926 .. 1926 C/A/G rs61995958 + CDS
1937 .. 1937 A/C rs143650593 + CDS Nonsynonymous[Thr606Pro]
1942 .. 1942 C/T rs201618750 + CDS Synonymous[Tyr607Tyr]
1945 .. 1945 C/T rs141270350 + CDS Synonymous[Ser608Ser]
1987 .. 1987 G/A rs191944347 + CDS Synonymous[Lys622Lys]
1997 .. 1997 C/T rs141725964 + CDS Nonsynonymous[Arg626Cys]
2020 .. 2020 C/T rs150569155 + CDS Synonymous[Phe633Phe]
2021 .. 2021 G/A rs149335528 + CDS Nonsynonymous[Glu634Lys]
2035 .. 2035 C/T rs56043893 + CDS Synonymous[Ser638Ser]
2074 .. 2074 G/A rs200743857 + 3'UTR
2198 .. 2198 G/A rs149820067 + 3'UTR
2295 .. 2295 G/A rs117808661 + 3'UTR
2299 .. 2299 G/A rs188462608 + 3'UTR
2414 .. 2414 G/A rs113041399 + 3'UTR
2449 .. 2449 G/A rs113631619 + 3'UTR
2450 .. 2450 A/T rs112529851 + 3'UTR
2450 ^ 2451 -/T rs11420839 + 3'UTR
2454 ^ 2455 -/T rs199664948 + 3'UTR
2508 .. 2508 C/G rs12567953 + 3'UTR
2529 .. 2529 A/G rs8159 - 3'UTR
2574 .. 2574 G/A rs142056615 + 3'UTR
2708 .. 2708 G/A rs115542970 + 3'UTR
2721 .. 2721 G/A rs181352749 + 3'UTR
2746 .. 2746 G/A rs10482 - 3'UTR
2792 .. 2792 C/T rs16846762 + 3'UTR
2826 .. 2826 G/A rs145779574 + 3'UTR
2855 .. 2855 A/G rs12565212 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;