H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000032262 Accession number: BC005171 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Chaperone activity of bc1 complex-like, mitochondrial; Chaperone-ABC1-like; EC=2.7.11.-; aarF domain-containing protein kinase 3; Precursor;
 
 

Motif information
ORF

length(647),orf(122:2065)
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQ
IGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD
QSAPPSLGHAHSEGPAPAYVASGPFREAGFPGQASSPLGRANGRLFANPR
DSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQTLSEH
ARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSEDPSGKKAVLG
SSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV
RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMK
GGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRR
ELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSG
FPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQ
HKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGY
EVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLV
PPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ*
a.a.
length
InterPro Name
length(50), motif(315:364) 50 IPR011009 Protein kinase-like domain [Domain]
length(115), motif(319:433) 115 IPR004147 UbiB domain [Domain]
length(127), motif(396:522) 127 IPR011009 Protein kinase-like domain [Domain]