H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000032422 Accession number: BC005377 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC=1.3.8.7; Precursor;
 
 

Motif information
ORF

length(421),orf(36:1301)
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQA
TARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL
GTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMT
EEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANW
YFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGI
VFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEAT
KYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRN
TYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIY
EGTSQIQRLIVAREHIDKYKN*
a.a.
length
InterPro Name
length(243), motif(36:278) 243 IPR009100 Acyl-CoA dehydrogenase/oxidase, N-terminal and middle domain [Domain]
length(114), motif(38:151) 114 IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal [Domain]
length(110), motif(42:151) 110 IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal [Domain]
length(99), motif(157:255) 99 IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain [Domain]
length(52), motif(157:208) 52 IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain [Domain]
length(13), motif(159:171) 13 IPR006089 Acyl-CoA dehydrogenase, conserved site [Conserved_site]
length(153), motif(267:419) 153 IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal [Domain]
length(148), motif(267:414) 148 IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal [Domain]
length(20), motif(374:393) 20 IPR006089 Acyl-CoA dehydrogenase, conserved site [Conserved_site]