H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000032906 Accession number: BC006536 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Symplekin;
 
 

Transcript original information
Accession number BC006536.2
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:2963685
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SYMPK) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SYMPK);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 3916[bp] (No. of exon:26)[A:896 T:672 G:1150 C:1198]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Kidney, renal cell adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA Site: 3888(+) Signal: 3868-3872(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0015243
Genomic location  G-integra Help Chromosome 19
Location 19q13.32
Position 46318708- 46357705
Strand -
Possible duplicated location(s) NA
Gene structure 26 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8189
KEGG GENES KEGG GENES(8189)
GeneCard GeneCardSYMPK*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000164047
Predicted CDS 1..3777;  1258[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.832

Motif information
ORF

length(1258),orf(1:3777)
QFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQELIINKD
PTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNM
LLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAG
DIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRI
PRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQ
RPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLE
FQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKLEPNL
GEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVL
ISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGV
EQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEA
PQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSDVLKPLTDAQVEAMKLGAV
KRILRAEKAVACSGAAQVRIKILASLVTQFNSGLKAEVLSFILEDVRARL
DLAFAWLYQEYNAYLAAGASGSLDKYEDCLIRLLSGLQEKPDQKDGIFTK
VVLEAPLITESALEVVRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHV
LLDLSSHEKDKVRSQALLFIKRMYEKEQLREYVEKFALNYLQLLVHPNPP
SVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAI
ADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDK
VPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPI
VVKEVFNRLLGTQHGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKAT
NLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFV
...
a.a.
length
InterPro Name
length(1249), motif(10:1258) 1249 IPR021850 Symplekin/Pta1 [Family]
length(244), motif(15:258) 244 IPR016024 Armadillo-type fold [Domain]
length(137), motif(46:182) 137 IPR011989 Armadillo-like helical [Domain]
length(48), motif(214:261) 48 IPR011989 Armadillo-like helical [Domain]
length(100), motif(653:752) 100 IPR011989 Armadillo-like helical [Domain]
length(92), motif(659:750) 92 IPR016024 Armadillo-type fold [Domain]
length(408), motif(659:1066) 408 IPR016024 Armadillo-type fold [Domain]
length(183), motif(871:1053) 183 IPR022075 Symplekin C-terminal [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000032906
H-Inv cluster ID Locus viewHIX0015243
Accession number BC006536.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Symplekin;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q92797)  [Identity/coverage = 97.456%/98.74%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 87694239330635958544210669729120066611470203914707147154893341623052818669648186882551969033220068231208618392126946023070812ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol SYMPK
HGNC aliases NA
HGNC name symplekin
DDBJ SYMPK
UniProt SYMPK
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000164047
No. of interaction 7
Interaction partner(s) HIP000028200HIP000036307HIP000063852HIP000085589HIP000096853HIP000117215HIP000165433
BIND NA
DIP 103593E;  115803E;  116853E;  117417E;  144838E;  185325E; 
MINT MINT-6802510;  MINT-6802610;  MINT-6802626;  MINT-72783;  MINT-7945693;  MINT-7947479;  MINT-8198073; 
HPRD 00778;  00883;  02652;  04184;  04340;  05824;  05825;  09581; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8189
KEGG GENES KEGG GENES(8189)
GeneCard GeneCardSYMPK*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function binding (GO:0005488); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  peroxisome; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
683 1078 1u6gC 3e-06 8.2 389/1146 a.118.1.2
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB020819; 
Affymetrix
GeneChip
HG-Focus 32402_s_at; 
HG-U133 202339_at;  32402_s_at; 
HG-U133A 202339_at;  32402_s_at; 
HG-U133A_2 202339_at;  32402_s_at; 
HG-U133B NA
HG-U133_Plus_2 202339_at;  32402_s_at; 
HG-U95 32402_s_at;  52396_s_at; 
HG-U95A 32402_s_at; 
HG-U95B 52396_s_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3865716;  3865717;  3865718;  3865719;  3865720;  3865721;  3865722;  3865724;  3865727;  3865728;  3865729;  3865731;  3865737;  3865738;  3865739;  3865740;  3865742;  3865744;  3865745;  3865747;  3865748;  3865749;  3865750;  3865751;  3865753;  3865754;  3865756;  3865757;  3865759;  3865760; 
HuGeneFL U88726_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P78808; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P78808; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
27 .. 27 G/A rs115183531 - CDS Synonymous[Pro9Pro]
100 .. 100 T/G rs201588333 - CDS Nonsynonymous[Ser34Ala]
186 .. 186 C/T rs188023108 - CDS Synonymous[Ile62Ile]
264 .. 264 C/T rs2303014 + CDS Synonymous[Ile88Ile]
399 .. 399 C/A rs3206292 + CDS Synonymous[Val133Val]
498 .. 498 C/T/G rs113726151 - CDS
499 .. 499 G/A rs146146730 - CDS Nonsynonymous[Ala167Thr]
545 .. 545 T/C rs74684616 - CDS Nonsynonymous[Met182Thr]
569 .. 569 G/T rs181097745 - CDS Nonsynonymous[Arg190Leu]
599 .. 599 T/A rs190807637 - CDS Nonsynonymous[Ile200Asn]
615 .. 615 C/G rs142993063 - CDS Synonymous[Pro205Pro]
619 .. 619 A/G/C rs138430981 - CDS
625 .. 625 T/C rs202218775 - CDS Nonsynonymous[Tyr209His]
640 .. 640 G/C rs144772956 - CDS Nonsynonymous[Glu214Gln]
720 .. 720 G/T rs149485173 - CDS Synonymous[Ala240Ala]
737 .. 737 A/G rs199889309 - CDS Nonsynonymous[Asn246Ser]
741 .. 741 C/T rs137962662 - CDS Synonymous[Ile247Ile]
783 .. 783 C/A rs200895369 - CDS Synonymous[Ala261Ala]
813 .. 813 G/A rs150307195 - CDS Synonymous[Pro271Pro]
852 .. 852 T/C rs141119918 - CDS Synonymous[Asn284Asn]
882 .. 882 G/A rs114012990 - CDS Synonymous[Lys294Lys]
888 .. 888 G/A rs146119096 - CDS Synonymous[Pro296Pro]
916 .. 916 A/G rs142237458 - CDS Nonsynonymous[Thr306Ala]
951 .. 951 C/T rs200729092 - CDS Synonymous[Ala317Ala]
998 .. 998 C/T rs150989264 - CDS Nonsynonymous[Pro333Leu]
1011 .. 1011 G/A rs199931319 - CDS Synonymous[Ser337Ser]
1089 .. 1089 A/G/C rs17850110 - CDS
1091 .. 1091 C/T rs111641417 - CDS Nonsynonymous[Ser364Leu]
1092 .. 1092 G/A rs34044830 - CDS Synonymous[Ser364Ser]
1107 .. 1107 C/T rs145760743 - CDS Synonymous[Ala369Ala]
1113 .. 1113 G/A rs143619467 - CDS Synonymous[Ala371Ala]
1122 .. 1122 C/T rs140016441 - CDS Synonymous[Ser374Ser]
1155 .. 1155 C/T rs201282044 - CDS Synonymous[Phe385Phe]
1229 .. 1229 T/C rs112765364 - CDS Nonsynonymous[Met410Thr]
1292 .. 1292 A/C rs146050594 - CDS Nonsynonymous[Lys431Thr]
1410 .. 1410 C/T rs12460761 - CDS Synonymous[Ser470Ser]
1454 .. 1454 C/T rs186314633 - CDS Nonsynonymous[Ser485Leu]
1455 .. 1455 G/A rs181234868 - CDS Synonymous[Ser485Ser]
1473 .. 1473 C/T rs139386869 - CDS Synonymous[Ser491Ser]
1526 .. 1526 C/T rs150881076 - CDS Nonsynonymous[Pro509Leu]
1593 .. 1593 C/T rs35532874 - CDS Synonymous[Ser531Ser]
1644 .. 1644 C/T rs185128526 - CDS Synonymous[Gly548Gly]
1663 .. 1663 C/T rs148441077 - CDS Nonsynonymous[Arg555Trp]
1664 .. 1664 G/T/A rs138091080 - CDS
1690 .. 1690 G/A rs142715646 - CDS Nonsynonymous[Gly564Arg]
1717 .. 1717 C/T rs138674985 - CDS Synonymous[Leu573Leu]
1745 .. 1745 C/T rs145738629 - CDS Nonsynonymous[Ser582Leu]
1758 .. 1758 G/A rs143732577 - CDS Synonymous[Ala586Ala]
1796 .. 1796 G/A rs141706016 - CDS Nonsynonymous[Arg599His]
1827 .. 1827 G/A rs200536983 - CDS Synonymous[Gln609Gln]
1859 .. 1859 C/T rs146919889 - CDS Nonsynonymous[Ser620Leu]
1860 .. 1860 G/A rs150362520 - CDS Synonymous[Ser620Ser]
1894 .. 1894 C/T rs140275801 - CDS Nonsynonymous[Arg632Cys]
1911 .. 1911 G/C rs141129629 - CDS Synonymous[Leu637Leu]
1998 .. 1998 C/G rs62109798 - CDS Synonymous[Val666Val]
2025 .. 2025 C/T rs151283297 - CDS Synonymous[Arg675Arg]
2078 .. 2078 G/A rs145063068 - CDS Nonsynonymous[Arg693His]
2092 .. 2092 C/T rs35490979 - CDS Synonymous[Leu698Leu]
2101 .. 2101 C/G rs200674455 - CDS Nonsynonymous[Leu701Val]
2106 .. 2106 C/T rs189256616 - CDS Synonymous[Leu702Leu]
2152 .. 2152 C/T rs146548789 - CDS Synonymous[Leu718Leu]
2171 .. 2171 A/G rs200272773 - CDS Nonsynonymous[Tyr724Cys]
2250 .. 2250 G/A rs144181896 - CDS Synonymous[Pro750Pro]
2283 .. 2283 G/A rs144079083 - CDS Synonymous[Glu761Glu]
2403 .. 2403 C/T rs61733457 - CDS Synonymous[Ala801Ala]
2415 .. 2415 G/A rs201720265 - CDS Synonymous[Arg805Arg]
2418 .. 2418 G/A rs145863416 - CDS Synonymous[Thr806Thr]
2481 .. 2481 G/C rs201483741 - CDS Synonymous[Leu827Leu]
2523 .. 2523 G/A rs7251942 - CDS Synonymous[Thr841Thr]
2610 .. 2610 A/G rs200830151 - CDS Synonymous[Pro870Pro]
2763 .. 2763 G/A rs200684200 - CDS Synonymous[Leu921Leu]
2766 .. 2766 C/T rs139861984 - CDS Synonymous[Ser922Ser]
2769 .. 2769 G/A rs147289776 - CDS Synonymous[Pro923Pro]
2815 .. 2815 G/A rs199576296 - CDS Nonsynonymous[Val939Met]
2865 .. 2865 G/T rs142763385 - CDS Synonymous[Ala955Ala]
2920 .. 2920 G/T rs184236600 - CDS AA-STOP[Glu974*]
2922 .. 2922 G/T rs193031994 - CDS Nonsynonymous[Glu974Asp]
3017 .. 3017 G/A rs201053291 - CDS Nonsynonymous[Arg1006His]
3048 .. 3048 C/T rs140350780 - CDS Synonymous[Pro1016Pro]
3102 .. 3102 C/A rs147142432 - CDS Nonsynonymous[Phe1034Leu]
3184 .. 3184 C/T rs199742453 - CDS Nonsynonymous[His1062Tyr]
3240 .. 3240 C/T rs114897351 - CDS Synonymous[Thr1080Thr]
3333 .. 3333 C/G rs1132645 + CDS Synonymous[Ala1111Ala]
3353 .. 3353 C/T rs201106907 - CDS Nonsynonymous[Pro1118Leu]
3452 .. 3452 C/T rs188360728 - CDS Nonsynonymous[Pro1151Leu]
3467 .. 3467 C/T rs201374282 - CDS Nonsynonymous[Pro1156Leu]
3471 .. 3471 T/G rs185654690 - CDS Synonymous[Ser1157Ser]
3502 .. 3502 C/T rs148068166 - CDS Nonsynonymous[Pro1168Ser]
3503 .. 3503 C/T rs143595032 - CDS Nonsynonymous[Pro1168Leu]
3539 .. 3539 C/T rs112323529 - CDS Nonsynonymous[Pro1180Leu]
3578 .. 3578 A/T rs149315096 - CDS Nonsynonymous[Asp1193Val]
3615 .. 3615 T/C rs116247729 - CDS Synonymous[Ser1205Ser]
3650 .. 3650 C/T rs201620603 - CDS Nonsynonymous[Ala1217Val]
3678 .. 3678 G/A rs144730714 - CDS Synonymous[Arg1226Arg]
3681 .. 3681 C/T rs141304179 - CDS Synonymous[Ser1227Ser]
3693 .. 3693 C/T rs146574843 - CDS Synonymous[Leu1231Leu]
3700 .. 3700 G/C rs1804616 + CDS Nonsynonymous[Val1234Leu]
3731 .. 3731 C/A rs145662570 - CDS Nonsynonymous[Pro1244Gln]
3796 .. 3796 G/C rs3810332 + 3'UTR
3800 .. 3800 G/- rs34838090 - 3'UTR
3833 .. 3833 G/T rs4991330 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
MamRTE1 2447 2540 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer