H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000033286 Accession number: BC007538 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: CCAAT/enhancer-binding protein beta; C/EBP beta; Liver activator protein; Nuclear factor NF-IL6; Transcription factor 5; TCF-5;
 
 

Motif information
ORF

length(345),orf(181:1218)
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPP
AARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAA
PPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKG
ALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMA
AGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYA
GAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC*
a.a.
length
InterPro Name
length(65), motif(269:333) 65 IPR004827 Basic-leucine zipper domain [Domain]
length(54), motif(270:323) 54 IPR004827 Basic-leucine zipper domain [Domain]
length(64), motif(271:334) 64 IPR004827 Basic-leucine zipper domain [Domain]