H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000033702 Accession number: BC008291 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Epoxide hydrolase 1; EC=3.3.2.9; Epoxide hydratase; Microsomal epoxide hydrolase;
 
 

Motif information
ORF

length(455),orf(26:1393)
MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRP
FKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNE
FDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGW
PGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFN
SVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNM
ALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM
HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSA
FPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLS
VLERQ*
a.a.
length
InterPro Name
length(419), motif(33:451) 419 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(408), motif(42:449) 408 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(113), motif(49:161) 113 IPR010497 Epoxide hydrolase, N-terminal [Domain]
length(19), motif(148:166) 19 IPR000639 Epoxide hydrolase-like [Family]
length(16), motif(177:192) 16 IPR000639 Epoxide hydrolase-like [Family]
length(217), motif(178:394) 217 IPR000073 Alpha/beta hydrolase fold-1 [Domain]
length(14), motif(222:235) 14 IPR000639 Epoxide hydrolase-like [Family]
length(14), motif(236:249) 14 IPR000639 Epoxide hydrolase-like [Family]
length(17), motif(394:410) 17 IPR000639 Epoxide hydrolase-like [Family]
length(23), motif(426:448) 23 IPR000639 Epoxide hydrolase-like [Family]