H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000033795 Accession number: BC008443 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Signal recognition particle 9 kDa protein; SRP9;
 
 

Motif information
ORF

length(86),orf(113:373)
MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLV
YKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE*
a.a.
length
InterPro Name
length(85), motif(2:86) 85 IPR009018 Signal recognition particle, SRP9/SRP14 subunit [Domain]
length(85), motif(2:86) 85 IPR008832 Signal recognition particle, SRP9 subunit [Family]
length(75), motif(5:79) 75 IPR009018 Signal recognition particle, SRP9/SRP14 subunit [Domain]