H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000035128 Accession number: BC010933 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Cytochrome c oxidase copper chaperone;
 
 

Transcript original information
Accession number BC010933.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:13542 IMAGE:4296970
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (COX17) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (COX17);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 438[bp] (No. of exon:3)[A:147 T:100 G:116 C:75]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Prostate
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 409(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0215273
Genomic location  G-integra Help Chromosome 3
Location 3q13.33
Position 119388380- 119396231
Strand -
Possible duplicated location(s) NA
Gene structure 3 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10063
KEGG GENES KEGG GENES(10063)
GeneCard GeneCardCOX17*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000083808
Predicted CDS 79..270;  63[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.748
Database links RefSeq NP_005685
UniProt Q14061
CCDS CCDS2993

Motif information
ORF

length(63),orf(79:270)
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIE
AHKECMRALGFKI*
a.a.
length
InterPro Name
length(63), motif(1:63) 63 IPR007745 Cytochrome c oxidase copper chaperone [Family]
length(57), motif(7:63) 57 IPR009069 Cysteine alpha-hairpin motif superfamily [Domain]
length(52), motif(12:63) 52 IPR007745 Cytochrome c oxidase copper chaperone [Family]
length(48), motif(16:63) 48 IPR007745 Cytochrome c oxidase copper chaperone [Family]
length(31), motif(27:57) 31 IPR009069 Cysteine alpha-hairpin motif superfamily [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000035128
H-Inv cluster ID Locus viewHIX0215273
Accession number BC010933.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Cytochrome c oxidase copper chaperone;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q14061)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 90509181098203814702039154893341809398221059946212694602181681722356826ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol COX17
HGNC aliases "COX17 (yeast) homolog, cytochrome c oxidase assembly protein", "COX17 homolog, cytochrome c oxidase assembly protein (yeast)", "COX17 homolog, cytochrome c oxidase assembly protein (S. cerevisiae)", "COX17 cytochrome c oxidase assembly homolog (S. cerevisiae)", "cytochrome c oxidase assembly homolog 17 (yeast)"
HGNC name COX17 cytochrome c oxidase copper chaperone
DDBJ COX17
UniProt COX17
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000083808
No. of interaction 3
Interaction partner(s) HIP000027036HIP000057717HIP000072382
BIND NA
DIP 103034E;  87850E;  87851E; 
MINT MINT-64163;  MINT-64164;  MINT-64165;  MINT-64167;  MINT-64168;  MINT-64169;  MINT-64170;  MINT-66362; 
HPRD 00559;  00887;  01859;  04927;  05201;  07171;  10603;  13173;  13753;  16735;  17975; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10063
KEGG GENES KEGG GENES(10063)
GeneCard GeneCardCOX17*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function copper chaperone activity (GO:0016531);  copper ion binding (GO:0005507); 
Biological process copper ion transport (GO:0006825); 
Cellular component mitochondrial intermembrane space (GO:0005758); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT extracellular;  cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Twilight zone
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
10 63 1u96A 4e-10 43.4 53/100 a.17.1.2
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA050308; 
Affymetrix
GeneChip
HG-Focus 203880_at; 
HG-U133 203880_at; 
HG-U133A 203880_at; 
HG-U133A_2 203880_at; 
HG-U133B NA
HG-U133_Plus_2 203880_at; 
HG-U95 40427_at; 
HG-U95A 40427_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2638119;  2638120;  2638122;  2690986;  2690990;  2690991;  3488593;  3488594;  3488595;  3513049; 
HuGeneFL L77701_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P428388; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P65157; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
16 .. 16 G/C rs78442596 - 5'UTR
51 ^ 52 -/C rs34292626 - 5'UTR
82 .. 82 C/A rs11558038 + CDS Nonsynonymous[Pro2Thr]
83 .. 83 C/T rs11558040 + CDS Nonsynonymous[Pro2Leu]
85 .. 85 G/A rs141108342 - CDS Nonsynonymous[Gly3Ser]
150 .. 150 C/T rs61736422 - CDS Synonymous[Cys24Cys]
192 .. 192 C/T rs143622776 - CDS Synonymous[Ile38Ile]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer