H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000035361 Accession number: BC011672 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to G protein-regulated inducer of neurite outgrowth 2.
 
 

Transcript original information
Accession number BC011672.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:15171 IMAGE:4300443
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (GPRIN2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (GPRIN2);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1896[bp] (No. of exon:2)[A:394 T:327 G:608 C:567]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Pancreas, epithelioid carcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1832(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0008795
Genomic location  G-integra Help Chromosome 10
Location 10q11.22
Position 46994920- 47000568
Strand +
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9721
KEGG GENES KEGG GENES(9721)
GeneCard GeneCardGPRIN2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000103503
Predicted CDS 136..1521;  461[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.805

Motif information
ORF

length(461),orf(136:1521)
MSSSHPEPGPWAPLSPRLQPLSQSSSSLLGEGREQRPELHKTASSTMWQA
QLGEASTRPQAPEEEGNPPESMKPARASGPKARPSAGGHWRSSTVGNVST
MGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSP
VHRAQLQPGGTSGQGGQAPAGLERDLAPEDETSNSAWMLGASQLSVPPLD
LGDTTAHSSSAQAEPKAAEQLATTTCHALPPAALLCGMREMREVGAGGCC
HALPATGILAFPKLVASVSESGLQAQHGVKIHCRLSGGLPGHSHCCAHLW
GPAGLVPEPGSRTKDVWTMTSANDLAPAEASPLSAQDAGVQAAPVAACKA
VATSPSLEAPAALHVFPEVTLGSSLEEAPSPVRDVRWDAEGMTWEVYGAA
VDPEVLGVAIQKHLEMQFEQLQRAPASEDSLSVEGRRGPLRAVMQSLRRP
SCCGCSGAAPE*
a.a.
length
InterPro Name
length(461), motif(1:461) 461 IPR026646 G protein-regulated inducer of neurite outgrowth [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000035361
H-Inv cluster ID Locus viewHIX0008795
Accession number BC011672.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Similar to G protein-regulated inducer of neurite outgrowth 2.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_055511)  [Identity/coverage = 98.035%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol GPRIN2
HGNC aliases "KIAA0514"
HGNC name G protein regulated inducer of neurite outgrowth 2
DDBJ GPRIN2
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000103503
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9721
KEGG GENES KEGG GENES(9721)
GeneCard GeneCardGPRIN2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol;  extracellular;  peroxisome;  plasma membrane; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB011010; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 1554541_a_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3245023;  3245024;  3245025;  3245026;  4037963;  4037968;  4037969;  4037970;  4037971; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P98115; 
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Gallus sp. (Chicken) AF151734 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000025545 G-integraG-integra
Orthology Macaca sp. (Macaque) ENSMMUT00000018862 G-integraG-integra
Orthology Monodelphis sp. (Opossum) ENSMODT00000003341 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000002688 G-integraG-integra
Orthology Rattus sp. (Rat) XM_001059778 G-integraG-integra
Orthology Equus sp. (Horse) XM_001500746 G-integraG-integra
Orthology Mus sp. (Mouse) XM_138975 G-integraG-integra
Orthology Bos sp. (Cow) XM_592057 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XR_024708 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
21 .. 21 A/G rs873875 + 5'UTR
41 .. 41 G/A rs61856080 + 5'UTR
71 .. 71 A/G rs28612335 + 5'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer