H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000035361 Accession number: BC011672 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to G protein-regulated inducer of neurite outgrowth 2.
 
 

Motif information
ORF

length(461),orf(136:1521)
MSSSHPEPGPWAPLSPRLQPLSQSSSSLLGEGREQRPELHKTASSTMWQA
QLGEASTRPQAPEEEGNPPESMKPARASGPKARPSAGGHWRSSTVGNVST
MGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSP
VHRAQLQPGGTSGQGGQAPAGLERDLAPEDETSNSAWMLGASQLSVPPLD
LGDTTAHSSSAQAEPKAAEQLATTTCHALPPAALLCGMREMREVGAGGCC
HALPATGILAFPKLVASVSESGLQAQHGVKIHCRLSGGLPGHSHCCAHLW
GPAGLVPEPGSRTKDVWTMTSANDLAPAEASPLSAQDAGVQAAPVAACKA
VATSPSLEAPAALHVFPEVTLGSSLEEAPSPVRDVRWDAEGMTWEVYGAA
VDPEVLGVAIQKHLEMQFEQLQRAPASEDSLSVEGRRGPLRAVMQSLRRP
SCCGCSGAAPE*
a.a.
length
InterPro Name
length(461), motif(1:461) 461 IPR026646 G protein-regulated inducer of neurite outgrowth [Family]