H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000035527 Accession number: BC011901 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Keratin, type I cytoskeletal 17; 39.1; Cytokeratin-17; CK-17; Keratin-17; K17;
 
 

Transcript original information
Accession number BC011901.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:20286 IMAGE:4111703
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (KRT17) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (KRT17);
Sequence data provider Provider:MGC/NCI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 1538[bp] (No. of exon:8)[A:358 T:252 G:469 C:459]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Muscle, rhabdomyosarcoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1499(+) Signal: 1477-1481(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) TAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0013818
Genomic location  G-integra Help Chromosome 17
Location 17q21.2
Position 39775694- 39780809
Strand -
Possible duplicated location(s) NA
Gene structure 8 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3872; 
KEGG GENES KEGG GENES(3872); 
GeneCard GeneCardKRT17;  *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000109336
Predicted CDS 49..1347;  432[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.88
Database links RefSeq NP_000413; 
UniProt Q04695; 
CCDS CCDS11402; 

Motif information
ORF

length(432),orf(49:1347) MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGS TLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD KVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEELQNKILTATV DNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLA RADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLS RILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVE EQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKK EPVTTRQVRTIVEEVQDGKVISSREQVHQTTR* 		a.a.
length		 InterPro Name
length(424), motif(9:432) 424 IPR001664 Intermediate filament protein [Family]
length(310), motif(84:393) 310 IPR001664 Intermediate filament protein [Family]
length(14), motif(162:175) 14 IPR002957 Keratin, type I [Family]
length(24), motif(183:206) 24 IPR002957 Keratin, type I [Family]
length(117), motif(194:310) 117 IPR009053 Prefoldin [Family]
length(21), motif(237:257) 21 IPR002957 Keratin, type I [Family]
length(16), motif(309:324) 16 IPR002957 Keratin, type I [Family]
length(27), motif(335:361) 27 IPR002957 Keratin, type I [Family]
length(9), motif(381:389) 9 IPR018039 Intermediate filament protein, conserved site [Conserved_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000035527
H-Inv cluster ID Locus viewHIX0013818
Accession number BC011901.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Keratin, type I cytoskeletal 17; 39.1; Cytokeratin-17; CK-17; Keratin-17; K17;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q04695)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1281771;  1372562;  2481679;  7539673;  9008238;  9767294;  10571744;  10651700;  10844551;  11348474;  11874497;  11886499;  14702039;  15102078;  15489334;  15608502;  15795121;  15795125;  16620218;  16625196;  16713453;  17081983;  18669648;  18691976;  20068231;  21269460;  ALL; 
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol KRT17
HGNC aliases "keratin 17"
HGNC name keratin 17, type I
DDBJ KRT17
UniProt KRT17
EC number NA
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000109336
No. of interaction 1
Interaction partner(s) HIP000115822; 
BIND NA
DIP NA
MINT MINT-61556;  MINT-67143;  MINT-7899812;  MINT-7900157; 
HPRD 00579;  01011;  01012;  01014;  01439;  01877;  03183;  04593;  07601;  16101; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3872; 
KEGG GENES KEGG GENES(3872); 
GeneCard GeneCardKRT17;  *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function structural molecule activity (GO:0005198); 
Cellular component intermediate filament (GO:0005882); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT mitochondria;  cytosol;  nuclear; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator		 AceGene AGhsA070201; 
Affymetrix
GeneChip		 HG-Focus 205157_s_at; 
HG-U133 205157_s_at;  212236_x_at; 
HG-U133A 205157_s_at;  212236_x_at; 
HG-U133A_2 205157_s_at;  212236_x_at; 
HG-U133B NA
HG-U133_Plus_2 205157_s_at;  212236_x_at; 
HG-U95 34301_r_at; 
HG-U95A 34301_r_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3713314;  3713315;  3713317;  3713318;  3713320;  3713323;  3713327;  3713328;  3714449;  3747440;  3747441;  3747444;  3747445;  3747447;  3747448;  3747450;  3747451;  3747452;  3747453;  3749290;  3749291;  3749292;  3749295;  3749301;  3749302;  3749304;  3749305;  3749306;  3751942;  3751945;  3751946;  3751948;  3751950;  3751953;  3757215;  3757216;  3757218;  3757221;  3757224;  3757227;  3757229;  3757230;  3757231;  3757232; 
HuGeneFL Z19574_rna1_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P96149; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P96158; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator; 

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Arrhythmogenic right ventricular dysplasia, familial, 12 (611528);  Disease name: Naxos disease (601214); 
Related information in OMIM OMIM ID:  173325;  Title: JUNCTION PLAKOGLOBIN
Co-localized orphan diseases NA
Disease related mutation MutationView:  173325; 
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(3872)
Disease Entrez Gene ID:(3872)
Substance Entrez Gene ID:(3872)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo Viewer;  LEGENDALEGENDA; 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
6 .. 6 C/T rs149859406 - 5'UTR
7 .. 7 T/C rs71373433 - 5'UTR
39 .. 39 C/T rs14253 + 5'UTR
43 .. 43 G/C rs11553457 + 5'UTR
44 .. 44 C/T rs187586045 - 5'UTR
58 .. 58 T/A rs111676549 - CDS Nonsynonymous[Ser4Thr]
96 .. 96 C/G rs11553456 + CDS Synonymous[Gly16Gly]
102 .. 102 C/T rs200589130 - CDS Synonymous[Ser18Ser]
114 .. 114 C/A rs77202564 - CDS Synonymous[Gly22Gly]
137 .. 137 G/A/C rs2229512 + CDS
179 .. 179 C/T rs147943933 - CDS Nonsynonymous[Ser44Phe]
199 .. 199 A/T rs201047424 - CDS Nonsynonymous[Thr51Ser]
204 .. 204 C/T rs144844141 - CDS Synonymous[Leu52Leu]
227 .. 227 G/C rs200841795 - CDS Nonsynonymous[Cys60Ser]
230 .. 230 A/G rs142502852 - CDS Nonsynonymous[Tyr61Cys]
232 .. 232 A/G rs11553455 + CDS Nonsynonymous[Ser62Gly]
269 .. 269 G/T rs200102896 - CDS Nonsynonymous[Gly74Val]
273 .. 273 T/C rs199533432 - CDS Synonymous[Gly75Gly]
281 .. 281 G/C rs11553454 + CDS Nonsynonymous[Gly78Ala]
311 .. 311 T/A/C rs28928898 + CDS
322 .. 322 A/C/G rs28928896 + CDS
323 .. 323 A/G rs59151893 + CDS Nonsynonymous[Asn92Ser]
327 .. 327 C/T rs147702566 - CDS Synonymous[Asp93Asp]
328 .. 328 C/T rs58730926 + CDS Nonsynonymous[Arg94Cys]
329 .. 329 G/A/C rs28928897 + CDS
332 .. 332 T/A/C rs28928899 + CDS
340 .. 340 T/G rs28933088 + CDS Nonsynonymous[Tyr98Asp]
344 .. 344 T/C rs28933089 + CDS Nonsynonymous[Leu99Pro]
352 .. 352 G/A rs59977263 + CDS Nonsynonymous[Val102Met]
357 .. 357 T/C rs57436765 + CDS Synonymous[Arg103Arg]
367 .. 367 G/A rs150004075 - CDS Nonsynonymous[Glu107Lys]
370 .. 370 G/A rs11553460 + CDS Nonsynonymous[Ala108Thr]
373 .. 373 A/G rs267607412 + CDS Nonsynonymous[Asn109Asp]
420 .. 420 C/T rs200866964 - CDS Synonymous[Ala124Ala]
423 .. 423 G/A rs139279688 - CDS Synonymous[Pro125Pro]
495 .. 495 C/T/G rs150822982 - CDS
504 .. 504 T/C rs142252437 - CDS Synonymous[Asn152Asn]
524 .. 524 T/C rs191021601 - CDS Nonsynonymous[Ile159Thr]
535 .. 535 C/G rs185719691 - CDS Nonsynonymous[Arg163Gly]
556 .. 556 C/T rs115084509 - CDS Nonsynonymous[Arg170Cys]
565 .. 565 T/G rs199897890 - CDS Nonsynonymous[Phe173Val]
616 .. 616 C/T rs146261696 - CDS Synonymous[Leu190Leu]
636 .. 636 G/A rs182165448 - CDS Synonymous[Glu196Glu]
654 .. 654 C/T rs141781644 - CDS Synonymous[Ala202Ala]
657 .. 657 C/T rs113335985 - CDS Synonymous[Asp203Asp]
665 .. 665 T/C rs138650610 - CDS Nonsynonymous[Met206Thr]
671 .. 671 T/C rs199795046 - CDS Nonsynonymous[Ile208Thr]
714 .. 714 C/T rs150142591 - CDS Synonymous[His222His]
715 .. 715 G/A rs140804147 - CDS Nonsynonymous[Glu223Lys]
729 .. 729 C/T rs147053246 - CDS Synonymous[Asn227Asn]
737 .. 737 G/A rs137961542 - CDS Nonsynonymous[Arg230Gln]
740 .. 740 G/C rs1126846 + CDS Nonsynonymous[Gly231Ala]
774 .. 774 C/T rs141627308 - CDS Synonymous[Asp242Asp]
777 .. 777 T/G rs150297631 - CDS Synonymous[Ala243Ala]
787 .. 787 G/A rs141092585 - CDS Nonsynonymous[Val247Met]
799 .. 799 C/T rs139367104 - CDS Nonsynonymous[Arg251Cys]
818 .. 818 G/A rs200256057 - CDS Nonsynonymous[Arg257His]
832 .. 832 A/T rs146900210 - CDS AA-STOP[Lys262*]
861 .. 861 C/A rs142566077 - CDS Synonymous[Ala271Ala]
900 .. 900 C/T rs147718833 - CDS Synonymous[Arg284Arg]
950 .. 950 C/T rs142893574 - CDS Nonsynonymous[Ser301Leu]
951 .. 951 G/A rs148958331 - CDS Synonymous[Ser301Ser]
993 .. 993 G/T rs145738125 - CDS Nonsynonymous[Gln315His]
1012 .. 1012 G/A rs149778356 - CDS Nonsynonymous[Ala322Thr]
1041 .. 1041 A/G rs140015248 - CDS Synonymous[Thr331Thr]
1048 .. 1048 C/T rs146280868 - CDS Nonsynonymous[Arg334Cys]
1057 .. 1057 G/A rs143477910 - CDS Nonsynonymous[Val337Met]
1092 .. 1092 C/T rs202225209 - CDS Synonymous[Ser348Ser]
1093 .. 1093 G/A rs142267571 - CDS Nonsynonymous[Val349Met]
1109 .. 1109 C/T rs139939142 - CDS Nonsynonymous[Ala354Val]
1113 .. 1113 G/A rs112789035 - CDS Synonymous[Gln355Gln]
1160 .. 1160 T/C rs267607413 + CDS Nonsynonymous[Leu371Pro]
1161 .. 1161 G/T rs56162829 - CDS Synonymous[Leu371Leu]
1172 .. 1172 C/T rs199906402 - CDS Nonsynonymous[Thr375Met]
1174 .. 1174 C/T rs200744890 - CDS Nonsynonymous[Arg376Trp]
1175 .. 1175 G/A rs150564761 - CDS Nonsynonymous[Arg376Gln]
1211 .. 1211 T/C rs56690581 + CDS Nonsynonymous[Leu388Pro]
1238 .. 1238 A/T rs141710767 - CDS Nonsynonymous[Gln397Leu]
1268 .. 1268 A/G rs200282135 - CDS Nonsynonymous[Gln407Arg]
1302 .. 1302 C/T rs3894230 + CDS Synonymous[Gly418Gly]
1317 .. 1317 C/T rs189096143 - CDS Synonymous[Ser423Ser]
1319 .. 1319 G/A rs148013099 - CDS Nonsynonymous[Arg424His]
1323 .. 1323 G/A rs117941474 - CDS Synonymous[Glu425Glu]
1331 .. 1331 A/G rs4079061 + CDS Nonsynonymous[His428Arg]
1371 .. 1371 A/C rs1809199 + 3'UTR
1394 .. 1394 G/A rs141130122 - 3'UTR
1401 .. 1401 C/T rs1043462 + 3'UTR
1416 .. 1416 C/T rs148274114 - 3'UTR
1486 .. 1486 T/C rs111650206 - 3'UTR
1492 .. 1492 C/A rs144113122 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;