H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000035536 Accession number: BC011910 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2; NADH-ubiquinone oxidoreductase MLRQ subunit homolog; NUOMS;
 
 

Motif information
ORF

length(87),orf(265:528)
MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCW
DRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF*
a.a.
length
InterPro Name
length(87), motif(1:87) 87 IPR010530 NADH-ubiquinone reductase complex 1 MLRQ subunit [Family]
length(73), motif(15:87) 73 IPR010530 NADH-ubiquinone reductase complex 1 MLRQ subunit [Family]