H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000036163 Accession number: BC013173 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: RING finger and SPRY domain-containing protein 1; Precursor;
 
 

Transcript original information
Accession number BC013173.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:17340 IMAGE:4340287
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (RSPRY1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (RSPRY1);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2084[bp] (No. of exon:15)[A:593 T:536 G:491 C:464]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lymph, lymphoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2068(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG;  TAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0013068
Genomic location  G-integra Help Chromosome 16
Location 16q13
Position 57220241- 57272946
Strand +
Possible duplicated location(s) NA
Gene structure 15 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:89970
KEGG GENES KEGG GENES(89970)
GeneCard GeneCardRSPRY1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000065808
Predicted CDS 279..2009;  576[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.709
Database links RefSeq NP_588609
UniProt Q96DX4
CCDS CCDS10775

Motif information
ORF

length(576),orf(279:2009)
MIVFGWAVFLASRSLGQGLLLTLEEHIAHFLGTGGAATTMGNSCICRDDS
GTDDSVDTQQQQAENSAVPTADTRSQPRDPVRPPRRGRGPHEPRRKKQNV
DGLVLDTLAVIRTLVDNDQEPPYSMITLHEMAETDEGWLDVVQSLIRVIP
LEDPLGPAVITLLLDECPLPTKDALQKLTEILNLNGEVACQDSSHPAKHR
NTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHPTVMLFALIAL
EKFAQTSENKLTISESSISDRLVTLESWANDPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVNLSSIRAMLNSNDVSEYLKISPHGLEARCDASSFESV
RCTFCVDAGVWYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCA
YDGCRQLIWYNARSKPHIHPCWKEGDTVGFLLDLNEKQMIFFLNGNQLPP
EKQVFSSTVSGFFAAASFMSYQQCEFNFGAKPFKYPPSMKFSTFNDYAFL
TAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLKPCGHSDLCMD
CALQLETCPLCRKEIVSRIRQISHIS*
a.a.
length
InterPro Name
length(169), motif(155:323) 169 IPR016024 Armadillo-type fold [Domain]
length(184), motif(300:483) 184 IPR001870 B30.2/SPRY domain [Domain]
length(123), motif(359:481) 123 IPR003877 SPRY domain [Domain]
length(46), motif(523:568) 46 IPR013083 Zinc finger, RING/FYVE/PHD-type [Domain]
length(35), motif(527:561) 35 IPR001841 Zinc finger, RING-type [Domain]
length(36), motif(527:562) 36 IPR001841 Zinc finger, RING-type [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000036163
H-Inv cluster ID Locus viewHIX0013068
Accession number BC013173.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition RING finger and SPRY domain-containing protein 1; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q96DX4)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1185331912975309147020391548933417974005ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol RSPRY1
HGNC aliases NA
HGNC name ring finger and SPRY domain containing 1
DDBJ RSPRY1
UniProt RSPRY1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000065808
No. of interaction 1
Interaction partner(s) HIP000142776
BIND NA
DIP 134193E;  134434E; 
MINT NA
HPRD 04269; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:89970
KEGG GENES KEGG GENES(89970)
GeneCard GeneCardRSPRY1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function zinc ion binding (GO:0008270);  protein binding (GO:0005515);  binding (GO:0005488); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT extracellular;  nuclear;  cytosol;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
291 488 2fnjA1 5e-19 13.5 192/217 b.29.1.22
501 574 1fbvA4 2e-08 23.3 73/79 g.44.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB150324; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 225770_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 225770_at; 
HG-U133_Plus_2 225770_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3662614;  3662621;  3662622;  3662624;  3662626;  3662628;  3662629;  3662631;  3662633;  3662636;  3662637;  3662639;  3662640;  3662643;  3662644;  3662645;  3662646;  3662647; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
36 .. 36 C/A rs11546963 + 5'UTR
38 ^ 39 -/T rs35398050 + 5'UTR
97 ^ 98 -/T rs34871304 + 5'UTR
100 .. 100 C/G rs74471685 + 5'UTR
125 .. 125 A/G rs141535938 + 5'UTR
198 .. 198 C/A rs73553028 + 5'UTR
311 .. 311 G/A rs201569191 + CDS Synonymous[Ala11Ala]
357 .. 357 A/G rs61746362 + CDS Nonsynonymous[Ile27Val]
390 .. 390 A/G rs139034588 + CDS Nonsynonymous[Thr38Ala]
418 .. 418 G/A rs200607629 + CDS Nonsynonymous[Arg47Gln]
426 .. 426 A/G rs149889245 + CDS Nonsynonymous[Ser50Gly]
467 .. 467 C/T rs147121129 + CDS Synonymous[Ala63Ala]
493 .. 493 A/G rs113552051 + CDS Nonsynonymous[Asp72Gly]
499 .. 499 G/A rs199640592 + CDS Nonsynonymous[Arg74Lys]
509 .. 509 A/G rs149224173 + CDS Synonymous[Pro77Pro]
522 .. 522 C/A rs200887019 + CDS Synonymous[Arg82Arg]
565 .. 565 A/G rs142385118 + CDS Nonsynonymous[Lys96Arg]
646 .. 646 A/T rs139606229 + CDS Nonsynonymous[Tyr123Phe]
686 .. 686 A/C rs146849995 + CDS Nonsynonymous[Glu136Asp]
783 .. 783 T/C rs140565458 + CDS Synonymous[Leu169Leu]
800 .. 800 A/G rs202149086 + CDS Synonymous[Ala174Ala]
908 .. 908 C/T rs145688335 + CDS Synonymous[Ala210Ala]
1203 .. 1203 A/T rs199502191 + CDS Nonsynonymous[Thr309Ser]
1221 .. 1221 T/C rs146588672 + CDS Synonymous[Leu315Leu]
1237 .. 1237 C/A rs78247072 + CDS Nonsynonymous[Ala320Asp]
1311 .. 1311 T/G rs140926092 + CDS Nonsynonymous[Ser345Ala]
1340 .. 1340 T/G rs111387495 + CDS Nonsynonymous[Phe354Leu]
1352 .. 1352 C/T rs190519504 + CDS Synonymous[Ala358Ala]
1391 .. 1391 C/T rs150201254 + CDS Synonymous[Gly371Gly]
1469 .. 1469 C/T rs60653561 + CDS Synonymous[Tyr397Tyr]
1495 .. 1495 A/G rs149541223 + CDS Nonsynonymous[Gln406Arg]
1530 .. 1530 A/G rs58714624 + CDS Nonsynonymous[Ile418Val]
1560 .. 1560 G/T rs199611065 + CDS Nonsynonymous[Val428Leu]
1582 .. 1582 A/G rs138832424 + CDS Nonsynonymous[Asn435Ser]
1613 .. 1613 C/T rs142839554 + CDS Synonymous[Gly445Gly]
1619 .. 1619 G/T rs201954899 + CDS Nonsynonymous[Gln447His]
1637 .. 1637 A/G rs140372775 + CDS Synonymous[Gln453Gln]
1686 ^ 1687 -/A rs35236945 + CDS
1826 .. 1826 G/C rs115476500 + CDS Synonymous[Leu516Leu]
1846 .. 1846 G/A rs201634523 + CDS Nonsynonymous[Arg523Gln]
1989 .. 1989 C/A rs191113490 + CDS Nonsynonymous[Gln571Lys]
2023 .. 2023 G/T rs182433621 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer