H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000036244 Accession number: BC013386 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A;
 
 

Transcript original information
Accession number BC013386.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:22830 IMAGE:3838524
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ORAI1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ORAI1);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1405[bp] (No. of exon:2)[A:262 T:250 G:397 C:496]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Bone marrow, acute myelogenous leukemia
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1377(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0022443
Genomic location  G-integra Help Chromosome 12
Location 12q24.31
Position 122064551- 122079939
Strand +
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84876
KEGG GENES KEGG GENES(84876)
GeneCard GeneCardORAI1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000062917
Predicted CDS 82..987;  301[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.822

Motif information
ORF

length(301),orf(82:987)
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAV
TYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA
MVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEA
VSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFL
PLKKQPGQPRPTSKPPAGGAAANVSTSGITPGQAAAIASTTIMVPFGLIF
IVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A*
a.a.
length
InterPro Name
length(202), motif(68:269) 202 IPR012446 Calcium release-activated calcium channel protein [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000036244
H-Inv cluster ID Locus viewHIX0022443
Accession number BC013386.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q96D31)  [Identity/coverage = 99.668%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 14702039154893341614797616582901166450491673352716766533168072331790572318669648204188712258610522641696ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ORAI1
HGNC aliases "transmembrane protein 142A"
HGNC name ORAI calcium release-activated calcium modulator 1
DDBJ ORAI1
UniProt ORAI1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000062917
No. of interaction 7
Interaction partner(s) HIP000039564HIP000066993HIP000079240HIP000081174HIP000101210HIP000102812HIP000112664
BIND NA
DIP 104016E;  104191E;  185610E; 
MINT MINT-8186918; 
HPRD 00241;  00242;  00243;  04710;  05803;  10079;  15999; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84876
KEGG GENES KEGG GENES(84876)
GeneCard GeneCardORAI1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane; 
Target P Other
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB080706; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 226531_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 226531_at; 
HG-U133_Plus_2 226531_at; 
HG-U95 46098_at; 
HG-U95A NA
HG-U95B 46098_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3434889;  3434890;  3434891;  3434897;  3434898;  3434899;  3434900;  3475273;  3475275;  3475290; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P258837; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P258837;  A_24_P146892; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Immune dysfunction with T-cell inactivation due to calcium entry defect 1 (612782); 
Related information in OMIM OMIM ID:  610277;  Title: TRANSMEMBRANE PROTEIN 142A
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(84876)
Disease Entrez Gene ID:(84876)
Substance Entrez Gene ID:(84876)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
262 .. 262 T/C rs201617764 + CDS Nonsynonymous[Ser61Pro]
321 .. 321 C/T rs199715755 + CDS Synonymous[Tyr80Tyr]
352 .. 352 C/T rs118203993 + CDS Nonsynonymous[Arg91Trp]
432 .. 432 G/- rs35949505 + CDS
586 ^ 587 -/CC rs151299882 + CDS
627 .. 627 C/T rs3741595 + CDS Synonymous[Ile182Ile]
733 .. 733 G/A rs3741596 + CDS Nonsynonymous[Gly218Ser]
749 .. 749 A/G rs75603737 + CDS Nonsynonymous[Asn223Ser]
774 .. 774 G/A rs200214435 + CDS Synonymous[Pro231Pro]
786 .. 786 C/T rs3741597 + CDS Synonymous[Ala235Ala]
867 .. 867 C/T rs3825174 + CDS Synonymous[Val262Val]
879 .. 879 C/T rs3825175 + CDS Synonymous[Thr266Thr]
966 .. 966 G/A rs187222480 + CDS Synonymous[Thr295Thr]
1037 .. 1037 A/T rs11548651 + 3'UTR
1073 .. 1073 T/C rs76753792 + 3'UTR
1106 .. 1106 G/A rs712853 - 3'UTR
1120 ^ 1121 -/T rs35558190 + 3'UTR
1144 .. 1144 C/T rs112873263 + 3'UTR
1172 .. 1172 C/T rs73227930 + 3'UTR
1193 .. 1193 C/T rs117741979 + 3'UTR
1208 .. 1208 T/C rs143888039 + 3'UTR
1212 ^ 1213 -/A rs34428119 + 3'UTR
1227 ^ 1228 -/A rs35143334 + 3'UTR
1236 .. 1236 G/T rs183557346 + 3'UTR
1272 .. 1272 C/T rs146865378 + 3'UTR
1332 .. 1332 T/C rs75886182 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer