H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000036244 Accession number: BC013386 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A;
 
 

Motif information
ORF

length(301),orf(82:987)
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAV
TYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA
MVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEA
VSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFL
PLKKQPGQPRPTSKPPAGGAAANVSTSGITPGQAAAIASTTIMVPFGLIF
IVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A*
a.a.
length
InterPro Name
length(202), motif(68:269) 202 IPR012446 Calcium release-activated calcium channel protein [Family]